BioLiP

>protein
TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQ

The query sequence (length=37) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4il6:X	40	37	1.0000	0.9250	1.0000	4.21e-19	3a0b:X, 3a0b:x, 5b5e:X, 5b5e:x, 5b66:X, 5b66:x, 7d1t:X, 7d1t:x, 7d1u:X, 7d1u:x, 6dhe:X, 6dhf:X, 6dhh:X, 6dho:X, 6dhp:X, 5e79:X, 5e7c:X, 5e7c:x, 7eda:X, 8ez5:X, 8ez5:x, 8f4d:X, 8f4d:x, 8f4e:X, 8f4f:X, 8f4f:x, 8f4g:X, 8f4h:X, 8f4i:X, 8f4i:x, 8f4j:X, 8f4j:x, 8f4k:X, 8gn0:x, 8gn1:x, 8gn2:x, 5h2f:X, 5h2f:x, 4il6:x, 8ir5:X, 8ir6:x, 8ir8:x, 8ira:X, 8irc:x, 8ird:x, 8ire:x, 8irf:x, 8iri:X, 8iri:x, 4ixr:X, 6jlj:X, 6jlj:x, 6jlk:X, 6jlk:x, 6jll:x, 6jlm:x, 6jln:X, 6jln:x, 6jlp:X, 6jlp:x, 5kaf:X, 5kai:X, 5kai:x, 3kzi:X, 5mx2:x, 4pbu:X, 4pbu:x, 7rf1:x, 7rf2:X, 7rf3:X, 7rf4:X, 7rf4:x, 7rf5:X, 7rf6:X, 7rf7:X, 7rf8:X, 7rf8:x, 4rvy:X, 4rvy:x, 5tis:x, 4ub6:X, 4ub8:X, 5v2c:X, 5v2c:x, 4v62:AX, 4v62:BX, 6w1o:X, 6w1o:x, 6w1p:X, 6w1r:X, 6w1t:X, 6w1u:X, 6w1v:X, 6w1v:x, 3wu2:X, 3wu2:x, 7yq2:X, 7yq2:x, 7yq7:x, 5zzn:x
2	5xnl:X	39	37	0.3784	0.3590	0.3784	7.44e-04	5xnl:x
3	6kaf:x	35	34	0.4324	0.4571	0.4706	0.001	6kaf:X, 8kde:X, 8zee:X
4	7pi0:X	30	21	0.3243	0.4000	0.5714	0.009	7pi0:x, 7pi5:X, 7pi5:x, 7pin:X, 7pin:X1, 7pin:x1, 7piw:X, 7piw:x, 7piw:x1, 7pnk:X, 7pnk:x
5	8wql:XD	40	36	0.4595	0.4250	0.4722	0.020	8wql:XE, 8wql:X1, 8wql:x1, 8wql:xD, 8wql:xE
6	7vd5:X	37	35	0.3784	0.3784	0.4000	0.033	6jlu:X, 6jlu:x, 7vd5:x
7	2axt:X	104	24	0.3514	0.1250	0.5417	0.19
8	7n8o:X	38	36	0.4324	0.4211	0.4444	0.49	7n8o:x, 7rcv:X, 7rcv:x, 8tow:X, 8tow:x, 6wj6:X
9	7oui:X	36	33	0.3514	0.3611	0.3939	1.5	7oui:x
10	1e3p:A	645	27	0.2973	0.0171	0.4074	6.4

[Back]