THVEVVATIAPQLYIEETLIQKINHRIDAIDVLELRIDQIENVTVNQVAEMITKLKVMQDSFKLLVTYRTKLQGGYGQFT
NDLYLNLISDLANINGIDMIDIEWQADIDIEKHQRIITHLQQYNKEVVISHHNFESTPPLDELQFIFFKMQKFNPEYVKL
AVMPHNKNDVLNLLQAMSTFSDTMDCKVVGISMSKLGLISRTAQGVFGGALTYGCIGEPQAPGQIDVTDLKAQVTLY
The query sequence (length=237) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8b2a:BBB | 238 | 237 | 1.0000 | 0.9958 | 1.0000 | 2.12e-178 | 8b2a:AAA, 1sfj:A, 1sfj:B, 6sfh:A, 6sfh:B |
2 | 8b2b:AAA | 252 | 217 | 0.3165 | 0.2976 | 0.3456 | 9.50e-35 | 8b2b:BBB, 8b2c:AAA, 4clm:B, 4cno:A, 4cno:B, 4cno:C, 4cno:D, 4cnp:A, 4cnp:B, 6h5c:A, 6h5c:B, 6h5d:A, 6h5d:B, 6h5g:A, 6h5j:A, 1l9w:A, 1l9w:B, 1l9w:C, 1l9w:D, 1qfe:A, 1qfe:B, 6sfe:A, 6sfe:B, 6sfg:A, 4uio:A |
3 | 4guh:B | 265 | 219 | 0.3165 | 0.2830 | 0.3425 | 1.20e-34 | 4gug:A, 4gug:B, 4guh:A, 4gui:A, 4gui:B, 4guj:A, 4guj:B, 4iuo:A, 4iuo:B, 3m7w:A, 3m7w:B, 3m7w:C, 3m7w:D, 3m7w:E, 3m7w:F, 3nnt:A, 3nnt:B |
4 | 4h3d:B | 254 | 211 | 0.2954 | 0.2756 | 0.3318 | 3.41e-33 | 4h3d:A, 4h3d:C, 4h3d:D, 3js3:A, 3js3:B, 3js3:C, 3js3:D |
5 | 2o7q:A | 501 | 208 | 0.2447 | 0.1158 | 0.2788 | 1.07e-14 | 6bmb:A, 6bmq:A, 2gpt:A, 2o7s:A |
6 | 5y7p:A | 327 | 45 | 0.0675 | 0.0489 | 0.3556 | 7.1 | 8bls:A, 8bls:B, 8bls:C, 8bls:D, 8bls:E, 8bls:F, 8bls:G, 8bls:H, 8blt:A, 8blt:B, 8blt:C, 8blt:D, 8blt:E, 8blt:F, 8blt:G, 8blt:H, 5y7p:F |
7 | 6mbn:A | 241 | 135 | 0.1224 | 0.1203 | 0.2148 | 7.4 | 6b89:A, 6b89:B, 6b8b:A, 6mbn:B, 6mgf:A, 6mhz:A, 6mhz:B, 6mi8:A, 6mi8:B, 6mit:B, 6mit:E, 4p31:A, 4p31:B, 4p32:A, 4p32:B, 4p33:A, 4p33:B, 4qc2:A, 4qc2:B, 6s8g:A, 6s8g:B, 6s8n:B |
8 | 4eue:A | 398 | 101 | 0.1097 | 0.0653 | 0.2574 | 9.5 | 4euf:A |