BioLiP

>protein
TGPNPNKQAVELNRTSLYWGLLLIFVLAVLFSSYFFN

The query sequence (length=37) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7vd5:L	38	37	1.0000	0.9737	1.0000	2.26e-21	8j5k:L, 8j5k:l, 7vd5:l, 8xlp:L
2	7y5e:L6	37	37	0.8919	0.8919	0.8919	2.34e-18	7y5e:l6, 7y7a:LO, 7y7a:lO, 7y7a:LZ, 7y7a:lZ, 4yuu:l2, 4yuu:L2
3	7pi0:L	38	35	0.8649	0.8421	0.9143	8.61e-18	7pi0:l, 7pi5:l, 7pin:l, 7pin:L1, 7piw:L, 7piw:L1, 7pnk:l
4	5xnm:L	37	37	0.8649	0.8649	0.8649	4.45e-17	5mdx:L, 5mdx:l, 7oui:L, 7oui:l, 5xnm:l
5	8wql:LD	38	33	0.7838	0.7632	0.8788	9.04e-15	8wql:LE, 8wql:L1
6	7ymi:L	36	35	0.7568	0.7778	0.8000	2.37e-08	7ymi:l, 7ymm:1L, 7ymm:2L, 7ymm:3L, 7ymm:4L
7	3a0b:L	37	35	0.8108	0.8108	0.8571	1.57e-06	3a0b:l, 5b66:L, 7czl:L, 7czl:l, 7dxh:l, 7eda:L, 5mx2:L, 5mx2:l, 7nhp:L, 7nhq:L, 4pj0:L, 4pj0:l
8	6wj6:L	31	31	0.6486	0.7742	0.7742	6.68e-04
9	3o5b:A	479	33	0.3243	0.0251	0.3636	1.5	3o5b:B, 3o80:A, 3o8m:A
10	5u4j:v	132	17	0.2162	0.0606	0.4706	6.1
11	6c4i:v	362	17	0.2162	0.0221	0.4706	6.3	6c4h:v, 5czp:XY, 5czp:QY, 5dfe:QY, 5dfe:XY, 5h5u:4, 5mdv:7, 5mdw:7, 5mgp:z, 1ml5:Z, 7o1c:B9, 6og7:8, 6ogf:8, 6ogg:8, 7oj0:8, 6ost:7, 6ot3:A, 6ouo:A, 8p16:6, 8p17:6, 8p18:6, 8qk7:6, 5u4i:v, 5u9f:Z, 5u9g:Z

[Back]