Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
TELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAK
KGDIVGPIRSGVGFHILKVNDLR

The query sequence (length=103) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 2pv3:A 284 102 0.9709 0.3521 0.9804 8.98e-68 2pv1:A, 2pv2:A, 2pv2:B, 2pv2:C, 2pv2:D, 2pv3:B
2 6vj6:A 258 106 0.2913 0.1163 0.2830 4.30e-06 6vj6:B
3 6s4c:A 185 27 0.1068 0.0595 0.4074 0.67
4 5ae6:B 767 75 0.2524 0.0339 0.3467 0.89 5a7m:A, 5a7m:B, 5ae6:A
5 7s9w:B 529 76 0.2136 0.0416 0.2895 2.2
6 8crx:E 179 22 0.0874 0.0503 0.4091 6.3 8cvo:E, 8cwo:E
7 6k15:H 393 49 0.1262 0.0331 0.2653 6.5 6kw4:H, 6kw5:H, 6v8o:I, 6v92:I
8 4aa1:A 598 37 0.1165 0.0201 0.3243 6.6 5a2r:A, 4aa2:A, 4asq:A, 4asr:A, 4ca7:A, 4ca8:A, 1j36:A, 1j36:B, 1j37:A, 1j37:B, 1j38:A, 1j38:B, 2x8y:A, 2x8z:A, 2x90:A, 2x91:A, 2x92:A, 2x93:A, 2x94:A, 2x95:A, 2x96:A, 2x97:A, 2xhm:A, 3zqz:A

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218