TELELLRQKADELNLQILKLINERGNVVKEIGKAKEQGVNRFDPVRERTMLNNIIENNDGPFENSTIQHIFKEIFKAGLE
LQEE
The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5gmu:B | 87 | 85 | 1.0000 | 0.9655 | 0.9882 | 1.71e-53 | 5gmu:A |
2 | 5j6f:A | 352 | 83 | 0.7024 | 0.1676 | 0.7108 | 2.49e-34 | 5j6f:B |
3 | 3nvt:A | 345 | 79 | 0.5833 | 0.1420 | 0.6203 | 1.55e-27 | 3nvt:B, 3tfc:A, 3tfc:B |
4 | 5ckx:D | 79 | 47 | 0.2262 | 0.2405 | 0.4043 | 0.003 | 5ckx:C, 2w1a:C, 2w1a:D |
5 | 1ecm:B | 95 | 53 | 0.2381 | 0.2105 | 0.3774 | 0.22 | 1ecm:A |
6 | 5a9t:A | 286 | 44 | 0.1786 | 0.0524 | 0.3409 | 1.3 | 5a9s:A, 5a9s:B, 5fwn:A, 5fwn:B |
7 | 6al9:B | 91 | 81 | 0.2262 | 0.2088 | 0.2346 | 4.0 | 6al9:A |
8 | 7o7t:A | 716 | 20 | 0.1190 | 0.0140 | 0.5000 | 5.0 | |
9 | 3i09:A | 375 | 33 | 0.1548 | 0.0347 | 0.3939 | 6.3 | 3i09:B |