BioLiP

>protein
TDSFLLRFLRARDFDLDLAWRLLKNYYKWRAECPEISADLHPRSIIGLLKAGYHGVLRSRDPTGSKVLIYRIAHWDPKVF
TAYDVFRVSLITSELIVQEVETQRNGIKAIFDLEGWQFSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVF
SMIKPFLTEKIKERIHMHGNNYKQSLLQHFPDILPLEYGGEEFSMEDICQEWTNFIMKSEDYLSSISESIQ

The query sequence (length=231) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1oiz:A	265	226	0.9784	0.8528	1.0000	9.86e-171	5mue:A, 5mug:A, 1oip:A, 1oiz:B, 1r5l:A, 3w67:A, 3w67:B, 3w67:C, 3w67:D, 3w68:A, 3w68:B, 3w68:D, 6zpd:A
2	3w68:C	252	230	0.9221	0.8452	0.9261	1.66e-163
3	4ciz:A	284	198	0.2857	0.2324	0.3333	1.78e-38	4cj6:A, 3hx3:A, 3hy5:A
4	4tlg:A	396	217	0.2857	0.1667	0.3041	1.62e-22	4tlg:B
5	1olm:E	397	213	0.2814	0.1637	0.3052	1.05e-20	1olm:A, 1olm:C, 4omj:A, 4omj:B, 4omk:A, 4omk:B
6	6f0e:A	300	218	0.2684	0.2067	0.2844	1.56e-14	7zg9:A, 7zg9:B, 7zga:A, 7zgb:A, 7zgc:A, 7zgd:A
7	3b7n:A	307	228	0.2641	0.1987	0.2675	4.40e-14	3b7z:A, 6sld:A
8	7y10:A	291	213	0.2468	0.1959	0.2676	3.77e-10	7y10:B, 7y11:A, 7y11:B
9	6w32:B	288	130	0.1126	0.0903	0.2000	0.043	6w32:A, 6w32:C
10	8bft:A	321	91	0.0996	0.0717	0.2527	0.93
11	4kl8:L	489	60	0.0779	0.0368	0.3000	1.4	1cc1:L, 4kl8:M, 4kn9:L, 4kn9:M, 4ko1:L, 4ko1:M, 4ko2:L, 4ko2:M, 4ko3:L, 4ko3:M, 4ko4:L, 4ko4:M
12	5bwe:A	857	78	0.0866	0.0233	0.2564	1.9	5bwd:A, 5bwe:D
13	3p3o:A	416	32	0.0563	0.0312	0.4062	4.6	3p3l:A, 3p3l:B, 3p3x:A, 3p3x:B, 3p3z:A
14	4mo5:A	345	36	0.0476	0.0319	0.3056	5.6
15	7pkt:r	158	38	0.0649	0.0949	0.3947	7.2

[Back]