TDRFKGDDDIPYKERLFERQQGKRAINYQILKNKGLTPKRNKDNRNSRVKKRKKYQKAQKKLKSVRAVYSGGQSGVYEGE
KTGIKKGLTRSVKFK
The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7d4i:5H | 95 | 95 | 1.0000 | 1.0000 | 1.0000 | 2.63e-63 | |
2 | 7aju:UC | 86 | 95 | 0.8842 | 0.9767 | 0.8842 | 7.91e-51 | 6zqd:UC, 6zqe:UC |
3 | 7suk:NB | 142 | 141 | 0.9263 | 0.6197 | 0.6241 | 3.55e-47 | 7ajt:UC, 7d5s:5H, 7d5t:5H, 7d63:5H, 6ke6:5H, 6lqp:5H, 6lqq:5H, 6lqr:5H, 6lqs:5H, 6lqt:5H, 6lqu:5H, 6lqv:5H, 5wlc:NB, 7wtl:UC, 6zqa:UC, 6zqb:UC, 6zqc:UC, 6zqf:UC, 6zqg:UC |
4 | 5oql:C | 74 | 74 | 0.4842 | 0.6216 | 0.6216 | 2.03e-18 | 6rxt:UC, 6rxu:UC, 6rxv:UC, 6rxx:UC, 6rxy:UC, 6rxz:UC |
5 | 7mqa:NB | 103 | 75 | 0.3789 | 0.3495 | 0.4800 | 9.96e-14 | 7mq8:NB, 7mq9:NB |
6 | 4typ:C | 190 | 57 | 0.2000 | 0.1000 | 0.3333 | 0.12 | 4typ:D |
7 | 6zu5:SD0 | 213 | 85 | 0.2421 | 0.1080 | 0.2706 | 1.5 | |
8 | 4wz9:B | 887 | 20 | 0.0947 | 0.0101 | 0.4500 | 3.8 | 4wz9:A |
9 | 7ri3:C | 583 | 50 | 0.1368 | 0.0223 | 0.2600 | 8.1 | 7ri3:A, 7ri3:B, 7ri3:D |
10 | 7wvt:A | 364 | 25 | 0.0947 | 0.0247 | 0.3600 | 10.0 | 7wwd:A, 7wwg:A |