BioLiP

>protein
TDQIAKNVKLDDFIPKRQSNFELSVPLPTKAEIQECTARTKSYIQRLVNAKLANSNNRASSRYVTANLLLNNSHHIEVVS
KQMDPLLPRFVGKKARKVVAPTENDEVVPVLHMDPNEWKIPAAVSNWKNPNGYTVALERRVTINDGFMKLSEALENADKK
ARQEIRSKME

The query sequence (length=170) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6bk8:E	186	171	0.9882	0.9032	0.9825	1.09e-117
2	5mps:K	187	188	0.9882	0.8984	0.8936	7.90e-116	7b9v:K, 5mq0:K
3	7dco:P	246	168	0.9294	0.6423	0.9405	7.15e-111	6exn:K, 5gm6:P, 5gmk:P, 6j6g:P, 6j6h:P, 6j6n:P, 6j6q:P, 5lj3:K, 5lj5:K, 5lqw:M, 5wsg:P, 5y88:Q, 5ylz:Q
4	3jb9:M	207	190	0.3529	0.2899	0.3158	1.90e-21
5	8ro0:R	282	156	0.2824	0.1702	0.3077	3.60e-16	8ro1:R
6	8i0u:R	380	191	0.3588	0.1605	0.3194	2.27e-15	8c6j:K, 8i0s:R, 8i0t:R, 8i0v:R, 8i0w:R, 6icz:R, 6id0:R, 6id1:R, 5mqf:C, 6qdv:K, 7w59:R, 7w5a:R, 7w5b:R, 5xjc:R, 5yzg:R, 6zym:C
7	6ff4:C	286	198	0.3588	0.2133	0.3081	5.98e-15	6ff7:C
8	9fmd:R	328	198	0.3588	0.1860	0.3081	1.19e-14	8ro2:R
9	7aav:v	206	159	0.3000	0.2476	0.3208	1.47e-09	7abi:v
10	8ch6:Y	306	176	0.3176	0.1765	0.3068	5.06e-09	7qtt:Y
11	7dvq:R	241	102	0.2176	0.1535	0.3627	2.67e-07
12	4zla:A	485	32	0.0765	0.0268	0.4062	1.5	4zi6:A, 4zi6:B, 4zi6:C, 4zi6:D, 4zi6:E, 4zi6:F, 4zla:B, 4zla:C, 4zla:D, 4zla:E, 4zla:F
13	6qv4:A	1666	63	0.1412	0.0144	0.3810	3.5	6qv3:A
14	1vp4:A	420	56	0.1176	0.0476	0.3571	5.3	1vp4:B
15	3fwz:A	140	58	0.1000	0.1214	0.2931	8.7	3fwz:B

[Back]