BioLiP

>protein
TAILYPFTISGNDRNGNFTINFKGTPNSTNNGCIGYSYNGDWEKIEWEGSCDGNGNLVVEVPMSKIPAGVTSGEIQIWWH
SGDLKMTDYKALEHHHHHH

The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5fu3:B	99	99	1.0000	1.0000	1.0000	2.31e-71	5fu2:A, 5fu2:B, 5fu3:A, 5fu4:A, 5fu4:B
2	4uy7:A	327	23	0.1111	0.0336	0.4783	0.27	6fnq:A, 6fnq:B, 6fnr:A, 6fnr:B, 6fns:A, 6fns:B, 6fnt:A, 6fnt:B, 4pin:A, 4pin:B, 4pio:A, 4pio:B, 4pip:A, 4pip:B, 4pip:C, 4pip:D, 4uy5:A, 4uy6:A, 4uy7:B
3	7onj:A	262	88	0.2020	0.0763	0.2273	0.38	7onj:B, 7onj:G, 7onj:C, 7onj:D, 7onj:E, 7onj:F, 7ooa:A, 7ooa:B, 7ooa:G, 7ooa:C, 7ooa:D, 7ooa:E, 7ooa:F
4	5mol:B	322	32	0.1212	0.0373	0.3750	0.61	6eyo:A, 4ezm:C, 4gko:C, 4j4p:A, 5moi:B, 5moi:D, 5mok:D, 5mol:A, 7mxi:B, 5nqw:A, 1o0v:A, 1o0v:B, 7shy:A, 7shy:B, 7shz:B, 7si0:B, 7si0:H
5	5cvc:A	329	34	0.1515	0.0456	0.4412	1.1	5cvc:B, 5cvc:C
6	4z6k:A	345	11	0.0909	0.0261	0.8182	1.3	4z6k:B, 4z6k:C, 4z6k:D
7	4ak2:A	286	38	0.1717	0.0594	0.4474	2.1
8	6iey:A	307	21	0.1010	0.0326	0.4762	3.9
9	3u4e:L	214	71	0.2020	0.0935	0.2817	4.6	8fk5:L
10	7nac:m	666	27	0.1010	0.0150	0.3704	4.9	8e5t:s, 6em1:m, 6em3:B, 7nad:m, 7ohp:m, 7ohs:m, 7ohw:m, 7ohx:m, 7r6q:m, 7r72:m, 7r7a:m, 8v87:m
11	6elz:m	645	27	0.1010	0.0155	0.3704	5.2	6em5:m, 7ohr:m, 7ohv:m
12	3t37:A	509	36	0.1212	0.0236	0.3333	5.6	4ha6:A
13	6cb1:s	512	25	0.1010	0.0195	0.4000	6.2	6c0f:s
14	8hfd:A	452	48	0.1212	0.0265	0.2500	6.5	3e74:B, 8hfd:B, 8hfd:C, 8hfd:D
15	3ip4:B	482	15	0.1010	0.0207	0.6667	9.8	2df4:B, 2dqn:B, 2f2a:B, 2g5h:B, 2g5i:B
16	5mc9:A	597	27	0.1212	0.0201	0.4444	9.8

[Back]