BioLiP

>protein
TAILYPFTISGNDRNGNFTINFKGTPNSTNNGCIGYSYNGDWEKIEWEGSCDGNGNLVVEVPMSKIPAGVTSGEIQIWWH
SGDLKMTDYKALEHHHH

The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5fu3:B	99	97	1.0000	0.9798	1.0000	1.17e-69	5fu2:A, 5fu2:B, 5fu3:A, 5fu4:A, 5fu4:B
2	7onj:A	262	86	0.2062	0.0763	0.2326	0.45	7onj:B, 7onj:G, 7onj:C, 7onj:D, 7onj:E, 7onj:F, 7ooa:A, 7ooa:B, 7ooa:G, 7ooa:C, 7ooa:D, 7ooa:E, 7ooa:F
3	5mol:B	322	32	0.1237	0.0373	0.3750	0.58	6eyo:A, 4ezm:C, 4gko:C, 4j4p:A, 5moi:B, 5moi:D, 5mok:D, 5mol:A, 7mxi:B, 5nqw:A, 1o0v:A, 1o0v:B, 7shy:A, 7shy:B, 7shz:B, 7si0:B, 7si0:H
4	5cvc:A	329	34	0.1546	0.0456	0.4412	0.93	5cvc:B, 5cvc:C
5	4uy7:A	327	22	0.1031	0.0306	0.4545	3.2	6fnq:A, 6fnq:B, 6fnr:A, 6fnr:B, 6fns:A, 6fns:B, 6fnt:A, 6fnt:B, 4pin:A, 4pin:B, 4pio:A, 4pio:B, 4pip:A, 4pip:B, 4pip:C, 4pip:D, 4uy5:A, 4uy6:A, 4uy7:B
6	3u4e:L	214	71	0.2062	0.0935	0.2817	3.7	8fk5:L
7	7nac:m	666	27	0.1031	0.0150	0.3704	4.3	8e5t:s, 6em1:m, 6em3:B, 7nad:m, 7ohp:m, 7ohs:m, 7ohw:m, 7ohx:m, 7r6q:m, 7r72:m, 7r7a:m, 8v87:m
8	6elz:m	645	27	0.1031	0.0155	0.3704	4.5	6em5:m, 7ohr:m, 7ohv:m
9	6cb1:s	512	25	0.1031	0.0195	0.4000	5.5	6c0f:s
10	8hfd:A	452	48	0.1237	0.0265	0.2500	6.2	3e74:B, 8hfd:B, 8hfd:C, 8hfd:D
11	2j07:A	419	14	0.0825	0.0191	0.5714	9.7	1iqr:A, 1iqu:A, 2j08:A, 2j09:A

[Back]