SYQDYINCSREALLEKMAELLPEKRLTHCLGVERAAMELAQRFGVDVEKASLAGLLHDYAKKLSDQEFLVLIDRYQLDPD
LKNWGNNVWHGMVGIYKIQEDLDLHDSEILRAIEIHTVGAGQMTDLDKVIYVADYIEHNRAFPGVDVAREIASLSLNKAV
AYETARTVEYLAHQGFPIYPQTLETYNAFVHYLK
The query sequence (length=194) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8jk9:A | 195 | 194 | 1.0000 | 0.9949 | 1.0000 | 1.61e-145 | 8jja:A, 8jjk:A, 8jk5:A, 8jk8:A, 8jka:A, 8jkp:A, 8jkr:A, 8yt5:A |
2 | 2ogi:B | 194 | 193 | 0.6546 | 0.6546 | 0.6580 | 1.11e-94 | 2ogi:A |
3 | 8wmy:A | 198 | 194 | 0.6546 | 0.6414 | 0.6546 | 1.05e-88 | 8wmy:B |
4 | 2o08:A | 187 | 182 | 0.3557 | 0.3690 | 0.3791 | 1.24e-39 | 2o08:B |
5 | 3ccg:A | 189 | 173 | 0.3402 | 0.3492 | 0.3815 | 5.47e-31 | |
6 | 4yfi:C | 269 | 145 | 0.1804 | 0.1301 | 0.2414 | 0.14 | 6b5j:A, 6b5j:B, 6b5j:C, 6b5j:D, 7mgj:A, 7mgj:B, 7mgj:C, 7mgj:D, 7mgk:A, 7mgk:B, 7mgk:C, 7mgk:D, 4yff:A, 4yff:B, 4yff:C, 4yff:D, 4yfi:A, 4yfi:B, 4yfi:D |
7 | 2pq7:A | 174 | 40 | 0.0773 | 0.0862 | 0.3750 | 0.28 | |
8 | 8dl7:A | 467 | 87 | 0.1186 | 0.0493 | 0.2644 | 0.79 | 8dl8:A |
9 | 8dl6:A | 442 | 86 | 0.1186 | 0.0520 | 0.2674 | 1.0 | 8bzy:A, 8c03:A, 6vyh:A, 6wbv:A |
10 | 2z7x:B | 520 | 104 | 0.1392 | 0.0519 | 0.2596 | 2.4 | |
11 | 2d7i:A | 536 | 59 | 0.1031 | 0.0373 | 0.3390 | 2.7 | 2d7r:A |
12 | 3ugg:A | 524 | 15 | 0.0464 | 0.0172 | 0.6000 | 9.8 | 3ugg:B, 3ugh:B |