SVVGSLIFCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQFSNLKVVTTTADDAFPSSLRAKK
The query sequence (length=63) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5n5y:I | 99 | 63 | 1.0000 | 0.6364 | 1.0000 | 4.18e-41 | 5n5z:I, 5n60:I |
2 | 6hlq:I | 111 | 63 | 1.0000 | 0.5676 | 1.0000 | 4.45e-41 | 5g5l:I, 6hls:I |
3 | 4c2m:I | 124 | 63 | 1.0000 | 0.5081 | 1.0000 | 4.58e-41 | 4c2m:X, 4c3h:I, 4c3i:I, 4c3j:I, 6h67:I, 6h68:I, 6hko:I, 6hlr:I, 5lmx:I, 5m3f:I, 5m3m:I, 5m5x:I, 5n61:I, 5oa1:I, 6rqt:I, 6ruo:I, 6rwe:I, 6tps:I, 5w5y:I, 5w64:I, 5w65:I, 5w66:I, 4ym7:AI, 4ym7:BI, 4ym7:CI, 4ym7:DI, 4ym7:EI, 4ym7:FI |
4 | 7aoc:I | 57 | 59 | 0.4444 | 0.4912 | 0.4746 | 6.63e-14 | 7aod:I, 7aod:U, 7aoe:I |
5 | 5eya:G | 86 | 25 | 0.1905 | 0.1395 | 0.4800 | 0.60 | 5eya:F, 5fer:A, 5fer:D |
6 | 6rr0:B | 118 | 28 | 0.1429 | 0.0763 | 0.3214 | 6.2 | 6qsz:A, 6qsz:K, 6qsz:C, 6qsz:E, 6qsz:G, 6qsz:I, 6qsz:M, 6qsz:O, 6qtm:C, 6qtm:B, 6qtm:A, 6rr0:A, 6rr0:E, 6rr0:D, 6rr0:C, 6rr0:F, 6rr0:G |
7 | 4o1e:A | 271 | 47 | 0.1587 | 0.0369 | 0.2128 | 6.9 | 4o1e:B, 4o1f:A, 4o1f:B |
8 | 8ag6:B | 975 | 29 | 0.1587 | 0.0103 | 0.3448 | 7.2 | 2o8b:B, 2o8c:B, 2o8d:B, 2o8e:B, 2o8f:B |
9 | 8em7:A | 4378 | 49 | 0.2381 | 0.0034 | 0.3061 | 7.5 | 8em7:B, 8jut:A, 8jut:B, 8juu:B, 8juu:A, 8jx8:B, 8jx8:A, 8jx9:B, 8jxa:A, 8jxb:A, 8jxd:A, 8jxe:A, 8jxe:B, 8jxf:B, 8jxg:A, 8jxh:A, 8jxi:B |
10 | 2a3c:A | 395 | 27 | 0.2063 | 0.0329 | 0.4815 | 9.0 | 2a3a:A, 2a3a:B, 2a3b:A, 2a3b:B, 2a3c:B, 2a3e:A, 2a3e:B, 3ch9:A, 3ch9:B, 3chc:A, 3chc:B, 3chd:A, 3chd:B, 3che:A, 3che:B, 3chf:A, 3chf:B, 2iuz:A, 2iuz:B, 1w9u:A, 1w9u:B, 1w9v:A, 1w9v:B |
11 | 4nmy:A | 299 | 36 | 0.2222 | 0.0468 | 0.3889 | 9.4 | 4nmy:B |