BioLiP

>protein
SVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFR

The query sequence (length=75) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7upg:A	75	75	1.0000	1.0000	1.0000	5.70e-50	8fug:A, 8fug:B, 8fug:C, 8fug:D, 8fug:E, 8fug:F, 8fug:G, 8fug:H, 8fug:I, 8fug:J, 8fug:K, 8fug:L, 8fug:M, 8fug:N, 8fug:O, 8fug:P, 8fug:Q, 8fug:R, 8fug:S, 8fug:T, 8fug:U, 8fug:V, 8fug:W, 7upg:F, 7upg:E, 7upg:B, 7upg:C, 7upg:D, 7upg:J, 7upg:I, 7upg:G, 7upg:H, 8uq7:A, 8uq7:B, 8uq7:C, 8uq7:D
2	8ttl:A	90	29	0.3867	0.3222	1.0000	4.33e-15	7sp1:B, 7sp1:C, 7sp1:F, 7sp1:G, 7sp1:J, 7sp1:L, 7sp1:N, 7sp1:A, 7sp1:D, 7sp1:E, 7sp1:H, 7sp1:I, 7sp1:K, 7sp1:M, 7sp1:O, 8ttl:B, 8ttl:C
3	8ttl:A	90	34	0.2133	0.1778	0.4706	1.27e-04	7sp1:B, 7sp1:C, 7sp1:F, 7sp1:G, 7sp1:J, 7sp1:L, 7sp1:N, 7sp1:A, 7sp1:D, 7sp1:E, 7sp1:H, 7sp1:I, 7sp1:K, 7sp1:M, 7sp1:O, 8ttl:B, 8ttl:C
4	2ayj:A	56	24	0.1600	0.2143	0.5000	2.1
5	5oql:a	179	41	0.1867	0.0782	0.3415	2.5	6rxt:CJ, 6rxu:CJ, 6rxv:CJ, 6rxx:CJ, 6rxy:CJ, 6rxz:CJ
6	7odv:DDD	595	25	0.1333	0.0168	0.4000	2.7	7odv:AAA, 7ogo:AAA, 7ogo:DDD, 7ogq:AAA, 7ogu:AAA, 7ogu:DDD, 7ogu:GGG, 7ogu:JJJ, 7ogz:AAA, 7ogz:DDD
7	3t7s:A	246	21	0.1067	0.0325	0.3810	3.1	3t7s:B, 3t7s:C, 3t7s:D, 3t7t:A, 3t7t:B, 3t7t:C, 3t7t:D
8	7p01:A	572	21	0.1467	0.0192	0.5238	5.1	7p01:B, 7p07:A, 7p07:B
9	3und:B	284	16	0.1200	0.0317	0.5625	8.6	3tmq:A, 3tmq:C, 3und:A, 3und:C, 3und:D

[Back]