BioLiP

>protein
STRYKTELCRPFEESGTCKYGEKCQFAHGFHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNADE

The query sequence (length=70) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1rgo:A	70	70	1.0000	1.0000	1.0000	1.02e-47
2	6nzl:A	78	71	0.5143	0.4615	0.5070	4.35e-19
3	6nzl:A	78	29	0.1571	0.1410	0.3793	0.91
4	1m9o:A	40	34	0.3571	0.6250	0.7353	4.07e-13
5	1m9o:A	40	35	0.2429	0.4250	0.4857	8.58e-07
6	6pmg:X	35	32	0.2571	0.5143	0.5625	3.67e-06
7	6pmg:X	35	30	0.2000	0.4000	0.4667	0.003
8	5elk:A	121	56	0.2857	0.1653	0.3571	4.35e-04
9	5elk:A	121	73	0.2857	0.1653	0.2740	1.2
10	5elk:A	121	25	0.1429	0.0826	0.4000	2.5
11	7dco:M	176	29	0.1286	0.0511	0.3103	0.017	5gm6:a
12	7dco:M	176	32	0.1143	0.0455	0.2500	0.078	5gm6:a
13	7dvq:M	191	35	0.1714	0.0628	0.3429	0.017	8i0r:K, 8i0s:K, 8i0t:K, 5z56:M, 5z58:M
14	7dvq:M	191	25	0.1286	0.0471	0.3600	0.089	8i0r:K, 8i0s:K, 8i0t:K, 5z56:M, 5z58:M
15	6ff4:t	172	35	0.1714	0.0698	0.3429	0.018	8ch6:Z, 6ff7:t, 7qtt:Z
16	6ff4:t	172	25	0.1286	0.0523	0.3600	0.087	8ch6:Z, 6ff7:t, 7qtt:Z
17	7k95:A	53	56	0.2571	0.3396	0.3214	0.021	7zyh:A, 7zyh:D, 7zyh:G, 7zyh:J
18	2fc6:A	50	29	0.1571	0.2200	0.3793	0.049
19	2wle:C	211	32	0.1857	0.0616	0.4062	0.057	2wle:A, 2wle:B, 2wlf:A, 2wlf:C, 2wlf:B, 2wlg:A, 2wlg:C, 2wlg:B
20	2cqe:A	98	63	0.2857	0.2041	0.3175	0.11
21	5elh:A	142	34	0.2429	0.1197	0.5000	0.52	5elh:B
22	2d9m:A	69	19	0.1571	0.1594	0.5789	0.95
23	8y6o:V	101	20	0.1286	0.0891	0.4500	1.0
24	8y6o:V	101	20	0.1286	0.0891	0.4500	5.6
25	6nzo:S	233	22	0.1571	0.0472	0.5000	1.4	6px3:S
26	5aj4:Ba	393	22	0.1429	0.0254	0.4545	3.1	6gaw:Ba, 6gb2:Ba, 7nqh:Ba, 7nql:Ba, 7nsh:Ba, 7nsi:Ba, 7nsj:Ba, 8oin:Bm, 8oiq:Bm, 6ydp:Ba, 6ydw:Ba
27	4ii1:B	139	28	0.1714	0.0863	0.4286	3.7	4ii1:A, 4ii1:C, 4ii1:D
28	3dty:A	374	28	0.1714	0.0321	0.4286	3.7	3dty:E
29	7dco:R	261	18	0.1000	0.0268	0.3889	7.0	7b9v:M, 6bk8:G, 6exn:M, 5gm6:R, 5gmk:R, 6j6g:R, 6j6h:R, 6j6n:R, 6j6q:R, 5lj3:M, 5lj5:M, 5mps:M, 5mq0:M, 3tp2:A, 3tp2:B, 3u1l:A, 3u1m:A, 5wsg:R, 5y88:N, 5ylz:N
30	2jfq:A	265	9	0.1143	0.0302	0.8889	7.2	2jfq:B
31	4c3b:C	178	18	0.1429	0.0562	0.5556	8.1	4c3b:A, 4c3b:B, 4c3b:D, 4c3b:E, 4c3b:F, 4c3b:G, 4c3b:H, 4c3b:I, 4c3b:J, 4c3b:K, 4c3b:L, 4c3b:M, 4c3b:N, 4c3b:O, 4c3b:P, 4c3e:A, 4c3e:B, 4c3e:C, 4c3e:D, 4c3e:E, 4c3e:F, 4c3e:G, 4c3e:H, 4c3e:I, 4c3e:J, 4c3e:K, 4c3e:L, 4c3e:M, 4c3e:N, 4c3e:O, 4c3e:P, 6g0y:F, 6g0y:E, 6g0y:A, 6g0y:C, 6pzq:B, 6pzq:D
32	2e5s:A	98	25	0.1857	0.1327	0.5200	8.5	3d2q:A, 3d2q:B, 3d2q:C, 3d2q:D, 3d2s:A, 3d2s:B, 3d2s:C, 3d2s:D
33	6pzq:A	157	18	0.1429	0.0637	0.5556	9.0	6pzq:C
34	1pn4:D	273	41	0.1714	0.0440	0.2927	9.2	1pn4:A, 1pn4:B

[Back]