STALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK
The query sequence (length=73) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2dyr:I | 73 | 73 | 1.0000 | 1.0000 | 1.0000 | 9.92e-49 | 2dyr:V, 2dys:I, 7ev7:V, 6jy3:I, 6jy4:I |
2 | 8b17:A | 451 | 30 | 0.1918 | 0.0310 | 0.4667 | 0.42 | 8b18:A, 8b19:A, 8b1a:A, 8b1b:A, 8b1c:A, 8b1d:A, 8b1e:A, 8b1f:A, 8b1g:A, 8b1h:A, 8b1i:A, 8b1j:A, 8b1k:A |
3 | 3j7a:1 | 120 | 60 | 0.2329 | 0.1417 | 0.2833 | 0.93 | 3jbn:1, 3jbo:1, 3jbp:1, 6okk:a, 8tpu:S1 |
4 | 6aci:A | 304 | 31 | 0.1781 | 0.0428 | 0.4194 | 5.2 | |
5 | 7y82:A | 1341 | 35 | 0.1507 | 0.0082 | 0.3143 | 8.3 | |
6 | 7p37:A | 147 | 15 | 0.1096 | 0.0544 | 0.5333 | 9.2 | 7p37:E, 7p37:I, 7p37:C, 7p37:G, 7p37:K, 7p37:B, 7p37:F, 7p37:J, 7p37:D, 7p37:H, 7p37:L, 7p3f:A, 7p3f:C, 7p3f:B, 7p3f:D, 7p3q:A, 7p3q:C, 7p3q:D, 7p3q:E, 7p3q:F, 7p3q:G, 7p3q:B, 7p3q:H |