STAKVTLVTSGGSSQDFTSEQTNITTDFARVRVTKGMWIFYQQANYNDASGGGSLWIKLDESSHLMDLPFTPRSFRPVKT
FQVGATLYKHVNFGGKELDLPNSNPRIDIGGVSSALISQGQWRLYEQYDYAGPSTRRGPGVYVNAGALGVANDALKSMER
E
The query sequence (length=161) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4iau:A | 161 | 161 | 1.0000 | 1.0000 | 1.0000 | 1.20e-119 | |
2 | 2bv2:A | 83 | 79 | 0.1677 | 0.3253 | 0.3418 | 1.95e-10 | 2bv2:B |
3 | 2k1w:A | 85 | 77 | 0.1553 | 0.2941 | 0.3247 | 3.59e-08 | 5ht9:A, 5ht9:B, 3hz2:A, 3hz2:B, 3hz2:C, 3hz2:D |
4 | 2k1w:A | 85 | 53 | 0.1180 | 0.2235 | 0.3585 | 0.055 | 5ht9:A, 5ht9:B, 3hz2:A, 3hz2:B, 3hz2:C, 3hz2:D |
5 | 5ht7:A | 82 | 60 | 0.1118 | 0.2195 | 0.3000 | 0.14 | 5ht7:B, 5ht7:C |
6 | 7el9:A | 1731 | 112 | 0.1925 | 0.0179 | 0.2768 | 0.35 | 7el9:D, 7elc:A |
7 | 7elb:A | 1937 | 112 | 0.1925 | 0.0160 | 0.2768 | 0.35 | 7ckm:A, 7elb:C, 6kld:A, 6kle:A, 6klh:A, 6klh:C |
8 | 7col:A | 280 | 56 | 0.0994 | 0.0571 | 0.2857 | 3.8 | 7col:B |
9 | 5ufv:A | 228 | 68 | 0.0994 | 0.0702 | 0.2353 | 4.8 | 5ufv:B, 5ufv:C, 5ufv:D, 5ufv:E, 5ufv:F |
10 | 5gws:B | 214 | 64 | 0.1118 | 0.0841 | 0.2812 | 5.6 | 5gws:C, 5gws:D |
11 | 3ik2:A | 512 | 88 | 0.1304 | 0.0410 | 0.2386 | 5.8 | |
12 | 8snb:8S | 304 | 84 | 0.1677 | 0.0888 | 0.3214 | 7.4 | |
13 | 7urg:A | 401 | 69 | 0.1429 | 0.0574 | 0.3333 | 8.7 | 7urg:B |