BioLiP

>protein
SSKAASLHWTSERAVSALLLGLLPAAYLYPGPAVDYSLAAALTLHGHWGLGQVITDYVHGDTPIKVANTGLYVLSAITFT
GLCYFNYYDVGICKAVAMLWSI

The query sequence (length=102) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2h89:D	102	102	1.0000	1.0000	1.0000	1.97e-70	2fbw:D, 2fbw:Q, 2h88:D, 2h88:Q, 6myo:D, 6myp:D, 6myq:D, 6myr:D, 6mys:D, 6myt:D, 6myu:D, 2wqy:D, 2wqy:Q, 1yq3:D, 1yq4:D
2	3abv:D	102	102	0.7745	0.7745	0.7745	8.22e-47	3ae1:D, 3ae2:D, 3ae3:D, 3ae4:D, 3ae5:D, 3ae6:D, 3ae7:D, 3ae8:D, 3ae9:D, 3aea:D, 3aeb:D, 3aec:D, 3aed:D, 3aee:D, 3aef:D, 3aeg:D, 8gs8:D, 3sfd:D, 3sfe:D, 4ytp:D, 4yxd:D, 1zoy:D, 1zp0:D
3	5c2t:D	129	95	0.4020	0.3178	0.4316	1.98e-19	5c2t:H, 5c3j:D, 5c3j:H, 3vr8:D, 3vr8:H, 3vr9:D, 3vr9:H, 3vra:D, 3vra:H, 3vrb:D, 3vrb:H, 4ysx:D, 4ysx:H, 4ysy:D, 4ysy:H, 4ysz:D, 4ysz:H, 4yt0:D, 4yt0:H, 4ytm:D, 4ytm:H, 4ytn:D, 4ytn:H
4	8q7h:A	1403	46	0.1373	0.0100	0.3043	1.2
5	4ivk:A	404	22	0.0980	0.0248	0.4545	1.3
6	7anc:B	314	35	0.1078	0.0350	0.3143	2.3
7	7cxt:A	348	35	0.1078	0.0316	0.3143	2.3	7anc:A, 7cxt:B, 7m13:A, 7m13:B
8	6sjv:A	529	20	0.1176	0.0227	0.6000	2.5	6sqc:A
9	8ci0:AAA	666	30	0.1373	0.0210	0.4667	2.7	8ci0:BBB, 8ci0:CCC, 1itz:A, 1itz:B, 1itz:C
10	3x17:B	548	95	0.2745	0.0511	0.2947	3.0	3x17:A
11	5nd5:A	669	17	0.0980	0.0149	0.5882	3.6	5nd5:B
12	6g79:S	262	42	0.1569	0.0611	0.3810	4.1
13	5v54:B	383	42	0.1569	0.0418	0.3810	5.0	7c61:A, 4iaq:A, 4iar:A, 5v54:A
14	5aj4:BF	250	53	0.1471	0.0600	0.2830	7.2	4ce4:F, 6gaw:BF, 6gb2:BF, 7nqh:BF, 7nql:BF, 7nsh:BF, 7nsi:BF, 7nsj:BF, 8oin:BN, 8oiq:BN, 4v19:F, 6ydp:BF, 6ydw:BF
15	6gos:D	396	21	0.0980	0.0253	0.4762	9.6	6grg:D

[Back]