SRWATPGHEERPKGYFMNRTPPAPGQSRKWEDWELPCYITSFLTIVILGVGLNAKPDLSIETWAHQKALERLEMEKLAT
The query sequence (length=79) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 8beh:g | 79 | 79 | 1.0000 | 1.0000 | 1.0000 | 8.44e-56 | 7aqw:g |
| 2 | 7l56:F | 129 | 23 | 0.1266 | 0.0775 | 0.4348 | 6.0 | 7l56:H |
| 3 | 2djr:A | 76 | 40 | 0.1392 | 0.1447 | 0.2750 | 7.9 |
umich.edu