BioLiP

>protein
SRRMKTQEIKNVTLEDVDFLKNLGVWVEIYHHLEKGLLQQCFNLVKKNMEALYRQSSFGWDDSEKLKEMEMEKLEYICIF
EKTSKKLVGFLSFEDTVEAGLTCLYIYEIQLDEHIRGRNVGKWLLKNASILAYRRNLKYIFLTVFSANLNALNFYHHFDF
VPHESSPQEKKFRSGKVIHPDYYILYTKSRKDW

The query sequence (length=193) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4ua3:B	193	193	1.0000	1.0000	1.0000	5.32e-145	4ua3:A
2	7kd7:A	204	147	0.2591	0.2451	0.3401	2.57e-21	7kd7:D, 7kpu:D, 7kpu:A, 4u9v:B, 4u9w:B, 4u9w:A, 4u9w:C, 4u9w:D
3	1tiq:A	173	64	0.1244	0.1387	0.3750	0.001	1tiq:B
4	7ciw:A	216	87	0.1140	0.1019	0.2529	0.054	7civ:A, 7cix:A
5	6z00:A	156	63	0.0984	0.1218	0.3016	0.067	6yzz:A, 6z00:B
6	3pp9:A	176	57	0.1036	0.1136	0.3509	0.38	3pp9:B, 3pp9:C
7	7w1y:B	651	93	0.1347	0.0399	0.2796	0.59	7w1y:3
8	6xtx:3	608	93	0.1347	0.0428	0.2796	0.61
9	5f47:B	152	108	0.1192	0.1513	0.2130	0.61	5f47:A, 5f48:A, 5f48:B, 5f49:A, 5f49:B, 5f49:C, 5f49:D, 5u08:A, 5u08:B, 5u08:C, 5u08:D
10	5hgz:A	211	66	0.1036	0.0948	0.3030	0.70	5hh0:A, 5hh1:A, 5icv:A, 5icv:B, 5icw:A, 5icw:B, 5icw:C, 5icw:D
11	8tb9:D	443	60	0.0777	0.0339	0.2500	1.6	6c23:A, 6c23:Q, 6c24:A, 6c24:Q, 5wai:B, 5wai:F
12	8b9d:3	569	73	0.1036	0.0351	0.2740	2.3
13	2vi7:C	165	63	0.1036	0.1212	0.3175	3.0
14	1wwz:A	157	82	0.1192	0.1465	0.2805	3.1	1wwz:B
15	2b4b:B	170	70	0.1036	0.1176	0.2857	3.7	2b3v:A, 2b4b:A, 2b4d:A, 2b4d:B, 2b58:A, 3bj7:A, 3bj7:B, 3bj7:C, 3bj7:D, 3bj8:A, 3bj8:B, 3bj8:C, 3bj8:D, 2fxf:A, 2fxf:B, 2jev:A, 2jev:B
16	3di1:B	291	43	0.0622	0.0412	0.2791	6.6	3di1:A

[Back]