SRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAE
The query sequence (length=50) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2mvw:A | 51 | 50 | 1.0000 | 0.9804 | 1.0000 | 2.26e-31 | 6imq:A, 6imq:B, 6imq:C, 6imq:D, 2mvw:B |
2 | 6o5k:A | 46 | 30 | 0.2800 | 0.3043 | 0.4667 | 0.013 | 6o5k:B |
3 | 3t9k:A | 281 | 42 | 0.2800 | 0.0498 | 0.3333 | 5.0 | 4f1p:A, 4f1p:B, 3jue:A, 3jue:B, 3t9k:B |
4 | 6ici:A | 585 | 20 | 0.1800 | 0.0154 | 0.4500 | 7.1 |