SRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLA
The query sequence (length=49) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2mvw:A | 51 | 49 | 1.0000 | 0.9608 | 1.0000 | 9.24e-31 | 6imq:A, 6imq:B, 6imq:C, 6imq:D, 2mvw:B |
2 | 6o5k:A | 46 | 30 | 0.2857 | 0.3043 | 0.4667 | 0.011 | 6o5k:B |
3 | 3t9k:A | 281 | 42 | 0.2857 | 0.0498 | 0.3333 | 4.8 | 4f1p:A, 4f1p:B, 3jue:A, 3jue:B, 3t9k:B |
4 | 6ici:A | 585 | 20 | 0.1837 | 0.0154 | 0.4500 | 6.5 | |
5 | 5jcy:A | 371 | 29 | 0.2041 | 0.0270 | 0.3448 | 9.1 | 5jcz:C, 4kp3:A, 4kp3:B, 6ku0:A, 6ku0:C, 4lx2:A |
6 | 7wj9:A | 733 | 29 | 0.2041 | 0.0136 | 0.3448 | 9.9 | 7wj9:B, 7wj9:C, 7wj9:D, 7wj9:F, 7wj9:E, 7wjb:A, 7wjc:A, 7wjd:A, 7wje:A, 7wjf:A |