SQGVIGIFGDYAKAHDLAVGEVSKLVKKALSNEYPQLSFRYRDSIKKTEINEALKKIDPDLGGTLFVSNSSIKPDGGIVE
VKDDYGEWRVVLVAEAKHQGKDIINIRNGLLVGKRGDQDLMAAGNAIERSHKNISEIANFMLSESHFPYVLFLEGSNFLT
ENISITRPDGRVVNLEYNSGILNRLDRLTAANYGMPINSNLCINKFVNHKDKSIMLQAASIYTQGDGREWDSKIMFEIMF
DISTTSLRVLGRDLFEQLTSK
The query sequence (length=261) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1ckq:A | 261 | 261 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 1cl8:A, 1eri:A, 2oxv:A, 1qps:A, 1qrh:A, 1qri:A |
2 | 6esq:I | 347 | 143 | 0.1686 | 0.1268 | 0.3077 | 0.051 | |
3 | 1n5d:A | 288 | 30 | 0.0421 | 0.0382 | 0.3667 | 4.4 | |
4 | 7b1s:B | 466 | 125 | 0.1303 | 0.0730 | 0.2720 | 5.9 | 7b1s:E, 7b2c:B, 7b2c:E |
5 | 5mej:A | 499 | 49 | 0.0575 | 0.0301 | 0.3061 | 6.2 | 5e9n:A, 5mew:A, 5mhu:A, 5mhv:A, 5mhw:A, 5mhx:A, 5mhy:A, 5mhz:A, 5mi1:A, 5mi2:A, 5mia:A, 5mib:A, 5mic:A, 5mid:A, 5mie:A, 5mig:A, 6rgh:A, 6rgp:A, 6rhh:A, 6rhi:A, 6rho:A, 6rhp:A, 6rhr:A, 6rhu:A, 6rhx:A, 6ri0:A, 6ri2:A, 6ri4:A, 6ri6:A, 6ri8:A, 6rii:A, 6rik:A, 6ril:A |