SPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIY
The query sequence (length=50) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6wlw:V | 50 | 50 | 1.0000 | 1.0000 | 1.0000 | 4.02e-30 | 6wm2:V |
2 | 6jij:C | 298 | 36 | 0.2000 | 0.0336 | 0.2778 | 2.5 | 6jij:B, 6jij:A |
3 | 8rq4:A | 1402 | 28 | 0.2400 | 0.0086 | 0.4286 | 9.4 |