BioLiP

>protein
SPKCTECLQYLDDPELRYEQHPPDAVEEIQILTNERLSIFSYEDLPQHKLTCFSVYCKRGHLCPIDTGLIEKDVELLFSG
SAKPIYEDDPSPEGGINGKNFGPINEWWIAGFDGGEKALLGFSTSFAEYILMDPSPEYAPLFSVMQEKIYISKIVVEFLQ
SNPDSTYEDLINKIETTVPPCMLNLNRFTEDSLLRHAQFVVEQVESYDRAGFLSPCMRDLIKLAGV

The query sequence (length=226) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6pzv:G	242	241	1.0000	0.9339	0.9378	1.90e-164	6pzv:C
2	4wxx:B	1178	232	0.8540	0.1638	0.8319	6.53e-131	3epz:A, 3epz:B, 7lmk:A, 7lmk:B, 7lmk:C, 7lmk:D, 7lmm:A, 7lmm:B, 7lmm:C, 7lmm:D, 3pta:A, 7sfc:A, 7sfd:A, 7sfe:A, 7sff:A, 7sfg:A, 5wvo:C, 4wxx:A, 6x9i:A, 6x9j:A, 6x9k:A, 7xi9:A, 7xib:A, 5ydr:B, 4yoc:A
3	3av4:A	1140	232	0.7478	0.1482	0.7284	1.54e-114	3av5:A, 3av6:A, 4da4:B, 5gut:A, 5guv:A, 3pt9:A, 6w8v:B, 6w8w:A, 6w8w:B, 5wy1:A
4	7wuy:A	393	97	0.0929	0.0534	0.2165	1.4	7wuy:B, 7wvs:A, 7wvs:B, 7ww0:A, 7ww0:B
5	5t48:A	181	82	0.0973	0.1215	0.2683	2.0	5abu:A, 4axg:B, 4uec:A, 4uec:C
6	4dx9:2	91	42	0.0575	0.1429	0.3095	2.4
7	8ojc:A	395	17	0.0442	0.0253	0.5882	7.0
8	9enp:A	1072	17	0.0442	0.0093	0.5882	8.4	9enq:A, 8oja:A
9	8v1q:A	1097	17	0.0442	0.0091	0.5882	8.6	8exx:A, 7luf:A, 7luf:B, 8oj6:A, 8oj7:A, 8ojb:A, 8ojd:A, 8v1r:A, 8v1s:A, 8vq2:A, 8vq2:B
10	8v1t:A	1064	17	0.0442	0.0094	0.5882	8.7

[Back]