Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
SNYIHIRIQQRNGRKTLTTVQGVPEEYDLKRILKVLKKDFACNGNIVKDPEMGEIIQLQGDQRAKVCEFMISQLGLQKKN
IKIHGF

The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 6gsm:m 96 86 1.0000 0.8958 1.0000 4.79e-60 8cah:m, 6gsn:m, 3j80:j, 3j81:m, 3jam:j, 3jap:m, 4uer:F, 6zce:m
2 8s8f:m 77 86 0.8953 1.0000 0.8953 7.11e-50 8s8i:m
3 7a09:Z 110 86 0.6047 0.4727 0.6047 1.82e-31 9bln:W, 4kzx:l, 4kzy:l, 8pj1:p, 8ppk:p, 8ppl:Ip, 7qp6:p, 8xxn:C1, 6ybw:p, 6zmw:p, 6zp4:Z, 6zvj:N
4 4bts:AF 89 84 0.4186 0.4045 0.4286 1.80e-21 4bts:BF, 4bts:CF, 4bts:DF, 4v5o:AF, 4v5o:BF
5 7ase:V 97 83 0.3256 0.2887 0.3373 4.04e-18
6 5jb3:1 83 82 0.3488 0.3614 0.3659 2.04e-05 5jbh:1
7 5zcy:A 83 82 0.2907 0.3012 0.3049 1.27e-04
8 2dua:A 283 19 0.1163 0.0353 0.5263 1.1 2hjp:A
9 8ita:A 429 24 0.1279 0.0256 0.4583 3.5 8inp:A
10 3qj4:A 335 68 0.2209 0.0567 0.2794 4.6 3qj4:B
11 6jbr:A 465 41 0.1512 0.0280 0.3171 7.3 6jbr:B, 6jbr:D, 6jbr:F, 6jbr:H, 6jbr:K, 6jbr:M, 6jbr:O, 6jbw:A, 6jbw:B

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417