SNRFFQKFYLRCGNCSAIQRSAQGYQPIANPILFKSDEHCRNYHDEQRRAAGYSGMVVTCRCHRCERVHSNWKVLDAQQF
LDAKLRMTPEERAQRLW
The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7aih:BD | 97 | 97 | 1.0000 | 1.0000 | 1.0000 | 2.60e-71 | 7ane:BD |
2 | 6hiv:Be | 101 | 97 | 0.6495 | 0.6238 | 0.6495 | 6.31e-47 | 6hix:Be |
3 | 3bxv:A | 308 | 25 | 0.1134 | 0.0357 | 0.4400 | 2.7 | |
4 | 7r04:A | 2326 | 20 | 0.1031 | 0.0043 | 0.5000 | 2.9 | |
5 | 7pgr:N | 2423 | 20 | 0.1031 | 0.0041 | 0.5000 | 3.1 | 2d4q:A, 2d4q:B, 2e2x:B, 3p7z:B, 3pg7:B, 7pgq:F, 7pgr:F, 7pgs:F, 7pgt:F, 7pgu:F, 7pgu:N |
6 | 1z1n:X | 516 | 38 | 0.1546 | 0.0291 | 0.3947 | 3.6 | |
7 | 5cio:A | 770 | 42 | 0.1443 | 0.0182 | 0.3333 | 4.1 | 5cio:B |
8 | 4gy5:A | 215 | 48 | 0.1443 | 0.0651 | 0.2917 | 5.5 | 3ask:A, 3ask:B, 3ask:D, 3asl:A, 3db3:A, 7fb7:B, 4gy5:B, 6iiw:A, 2lgg:A, 2lgk:A, 2lgl:A, 4qqd:A, 4qqd:B, 3shb:A, 3sou:A, 3sou:B, 3sow:A, 3sow:B, 3sox:A, 3sox:B, 3t6r:B, 3t6r:A, 8wms:A, 5xpi:A, 5yy9:A, 5yy9:B, 3zvy:A, 3zvy:B, 3zvz:B |