SNPNPNKQPVELNRTSLFWGLLLIFVLAVLFSSYFFN
The query sequence (length=37) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7y5e:L6 | 37 | 37 | 1.0000 | 1.0000 | 1.0000 | 1.61e-20 | 7y5e:l6, 7y7a:LO, 7y7a:lO, 7y7a:LZ, 7y7a:lZ, 4yuu:l2, 4yuu:L2 |
2 | 7vd5:L | 38 | 37 | 0.8919 | 0.8684 | 0.8919 | 2.04e-18 | 8j5k:L, 8j5k:l, 7vd5:l, 8xlp:L |
3 | 7pi0:L | 38 | 37 | 0.8378 | 0.8158 | 0.8378 | 8.10e-17 | 7pi0:l, 7pi5:l, 7pin:l, 7pin:L1, 7piw:L, 7piw:L1, 7pnk:l |
4 | 5xnm:L | 37 | 37 | 0.8108 | 0.8108 | 0.8108 | 6.57e-16 | 5mdx:L, 5mdx:l, 7oui:L, 7oui:l, 5xnm:l |
5 | 8wql:LD | 38 | 33 | 0.7838 | 0.7632 | 0.8788 | 3.08e-15 | 8wql:LE, 8wql:L1 |
6 | 7ymi:L | 36 | 35 | 0.8108 | 0.8333 | 0.8571 | 1.55e-09 | 7ymi:l, 7ymm:1L, 7ymm:2L, 7ymm:3L, 7ymm:4L |
7 | 3a0b:L | 37 | 35 | 0.8108 | 0.8108 | 0.8571 | 3.75e-07 | 3a0b:l, 5b66:L, 7czl:L, 7czl:l, 7dxh:l, 7eda:L, 5mx2:L, 5mx2:l, 7nhp:L, 7nhq:L, 4pj0:L, 4pj0:l |
8 | 6wj6:L | 31 | 31 | 0.6486 | 0.7742 | 0.7742 | 7.43e-05 | |
9 | 8dev:B | 1043 | 22 | 0.2162 | 0.0077 | 0.3636 | 5.0 | 8deu:B, 8dew:B, 6vks:B, 6vkt:B |
10 | 5tlq:A | 190 | 19 | 0.2162 | 0.0421 | 0.4211 | 9.4 | 5dch:A, 4zl8:A |