BioLiP

>protein
SNAVQREDGSWLLDGLIAVPELKDTLGLRAVPEEEKGVYHTLSGMIMWLLGRLPQTGDITFWENWRLEVIDMDSKRIDKV
LATKID

The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2pls:I	86	86	1.0000	1.0000	1.0000	1.35e-58	2pls:G, 2pls:H, 2pls:J
2	3ded:C	91	82	0.4070	0.3846	0.4268	4.52e-20	3ded:A, 3ded:B, 3ded:D, 3ded:E, 3ded:F
3	2oai:A	80	83	0.3953	0.4250	0.4096	1.65e-19	2r8d:A
4	2p4p:B	77	74	0.2442	0.2727	0.2838	6.66e-12
5	4hg0:A	232	71	0.2093	0.0776	0.2535	0.003	3nqr:A, 3nqr:B, 3nqr:C, 3nqr:D, 5yz2:A, 5yz2:B
6	3lae:A	81	85	0.2326	0.2469	0.2353	0.017
7	2pli:A	84	75	0.1860	0.1905	0.2133	0.033	2pli:B, 2pli:C, 2pli:D
8	5h83:A	354	23	0.1279	0.0311	0.4783	3.6	5h83:B
9	2rg4:A	206	72	0.2093	0.0874	0.2500	4.2	2rg4:B
10	4o6o:D	199	32	0.1512	0.0653	0.4062	5.7	4o6o:A, 4o6o:B, 4o6o:C, 4o6p:B, 4o6p:C, 3vdp:A, 3vdp:B, 3vdp:C, 3vdp:D, 3vdu:A, 3ve5:D, 3ve5:A
11	5hau:1z	730	31	0.1047	0.0123	0.2903	6.4	2bm0:A, 2bm1:A, 1fnm:A, 6gzq:H1, 6gzx:H1, 6gzx:H2, 6gzz:H1, 6gzz:H2, 5hau:2z, 4m1k:A, 4myt:A, 4myu:A, 2om7:L, 5ot7:U, 6q95:G, 6ucq:1v, 6ucq:2v, 4v5f:AY, 4v5f:CY, 4v5m:AY, 4v5n:AY, 4v6t:AY, 4v8u:AY, 4v8u:CY, 4v90:AY, 4v9j:AY, 4v9j:CY, 4v9k:AY, 4v9k:CY, 4v9l:AY, 4v9l:CY, 4v9m:AY, 4v9m:CY, 4w29:AY, 4w29:CY, 4wpo:BZ, 4wpo:DZ, 4wqf:BZ, 4wqf:DZ, 4wqu:BZ, 4wqu:DZ, 4wqy:BZ, 4wqy:DZ
12	6kse:A	607	16	0.1047	0.0148	0.5625	7.7	6kse:B
13	7y4g:A	715	40	0.1512	0.0182	0.3250	9.8	8hay:A, 8hay:B, 8hay:C, 7y4g:B, 7y4g:C

[Back]