BioLiP

>protein
SNAASMNQLIQAQKKLLPDLLLVMQKRFEILQYIRLTEPIGRRSLSASLGISERVLRGEVQFLKEQNLVDIKTNGMTLTE
EGYELLSVLEDTMKD

The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8r3g:A	335	90	0.9474	0.2687	1.0000	2.79e-58	3bxf:A, 3bxg:A, 3bxg:B, 3bxh:A, 3bxh:B, 2okg:B, 7oyk:BBB, 7oyk:AAA, 7oyk:CCC, 7oyk:DDD, 8r3g:B, 8r3g:D, 8r3g:C
2	6xl5:G	268	47	0.1789	0.0634	0.3617	0.22	6wl5:A, 6wl5:B, 6wl5:C, 6wl5:D, 6xl5:H, 6xl6:G, 6xl6:H, 6xl9:G, 6xl9:H, 6xla:G, 6xla:H, 6xlj:G, 6xlj:H, 6xlk:G, 6xlk:H
3	4rdu:D	62	33	0.1474	0.2258	0.4242	0.61	4rdu:A, 4xrs:I, 4xrs:G
4	2amx:A	364	32	0.1474	0.0385	0.4375	3.7	2amx:B
5	2v5k:A	260	36	0.1474	0.0538	0.3889	4.2	4b5s:A, 4b5s:B, 4b5t:A, 4b5t:B, 4b5u:A, 4b5u:B, 4b5v:A, 4b5v:B, 4b5w:A, 4b5w:B, 4b5w:C, 4b5w:D, 4b5w:E, 4b5w:F, 2v5k:B
6	4v6i:Bs	257	33	0.1053	0.0389	0.3030	6.9	8ccs:DD, 8cdl:DD, 8cdr:DD, 8ceh:DD, 8cf5:DD, 8cg8:DD, 8cgn:DD, 8civ:DD, 8cku:DD, 8cmj:DD, 8eub:VA, 8evq:V, 8evr:V, 8evs:V, 8ewb:V, 6gq1:P0, 6gqb:P0, 6gqv:P0, 3j16:G, 5juo:VA, 5jup:VA, 5jus:VA, 5jut:VA, 5juu:VA, 8k2d:P0, 8k82:P0, 7osa:uL10, 7osm:uL10, 7rr5:P0, 4v7h:B8, 6woo:r, 6xiq:P0, 8y0u:P0
7	3uhf:A	255	60	0.1895	0.0706	0.3000	7.2	3uhf:B, 3uho:A, 3uho:B
8	2vwt:A	256	36	0.1474	0.0547	0.3889	7.5	2vwt:B, 2vwt:C
9	3ldg:A	377	35	0.1263	0.0318	0.3429	8.1
10	5it7:rr	195	33	0.1053	0.0513	0.3030	8.4	6uz7:Br
11	8r4z:A	341	37	0.1158	0.0323	0.2973	8.5	8r4z:B, 8rvc:A, 8rvc:B, 8rvs:A, 8rvs:B, 8rwm:A, 8rwm:B
12	7u5d:A	630	23	0.1053	0.0159	0.4348	9.6

[Back]