SMTRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVKPTLYIIKYDGKDSVYGLELHRDKRVLALEILPERVPTPRIDSR
LADSLIGKAVEHVFETKDEWKGMVLARAPVMDTWFYITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEQESLVGK
QVEHAKDDGSKRTGIFIHQVVAKPSVYFIKFDDDIHIYVYGLV
The query sequence (length=203) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4uy4:B | 208 | 208 | 1.0000 | 0.9760 | 0.9760 | 1.52e-146 | 4uy4:A |
2 | 7bqz:A | 215 | 209 | 0.7833 | 0.7395 | 0.7608 | 5.69e-111 | 7bqz:C, 7bqz:E, 7bqz:G, 7bu9:A, 7bu9:C, 7bu9:E, 7bu9:G, 7cna:D, 7cna:A, 7e9m:A, 7e9m:C, 7ea1:A, 8gtx:A, 4h75:A, 5jsg:A, 5jsg:B, 5jsj:A, 5jsj:B, 4mzf:B, 4mzg:B, 4mzg:D, 4mzh:A, 2ns2:A, 7ocb:B, 5y5w:A, 5y5w:C |
3 | 5y5w:B | 195 | 203 | 0.7192 | 0.7487 | 0.7192 | 1.08e-99 | 7ea1:C, 6i8b:B, 6i8b:E, 6i8l:B, 6i8y:A, 6qpl:B |
4 | 5lug:A | 207 | 205 | 0.6847 | 0.6715 | 0.6780 | 4.65e-99 | 5lug:D, 5lug:C, 5lug:B |
5 | 6lx2:A | 523 | 83 | 0.1281 | 0.0497 | 0.3133 | 0.020 | 6lx1:A |
6 | 3gvj:A | 670 | 76 | 0.1084 | 0.0328 | 0.2895 | 0.76 | 3gvk:A, 3gvk:B, 3gvk:C, 3gvl:A, 3ju4:A, 1v0f:C, 1v0f:D, 1v0f:E, 1v0f:A, 1v0f:B, 1v0f:F |
7 | 8tzh:A | 1485 | 60 | 0.0739 | 0.0101 | 0.2500 | 1.0 | 3d6t:B |
8 | 4lv7:A | 390 | 31 | 0.0591 | 0.0308 | 0.3871 | 2.6 | 3uds:A, 3uds:B |
9 | 6phv:A | 721 | 77 | 0.1034 | 0.0291 | 0.2727 | 3.4 | 6phw:A, 6phx:A, 6phy:A, 6pi0:A |
10 | 6fl3:B | 420 | 31 | 0.0591 | 0.0286 | 0.3871 | 5.6 | 4axc:A, 4axf:A, 6fjk:B, 6fl8:B, 6gfg:B, 6gfg:A, 6gfh:A, 6gfh:B, 4lv7:B, 3udt:A, 3udt:B, 3udz:A, 3udz:B, 2xan:A, 2xao:A |
11 | 7eus:B | 291 | 44 | 0.0542 | 0.0378 | 0.2500 | 5.6 | 7eus:A, 7eut:A, 7eut:B, 7euu:A, 7euu:B |
12 | 7nhk:W | 91 | 81 | 0.1084 | 0.2418 | 0.2716 | 5.7 | 6o8w:U, 6o8x:U, 6o8y:U, 6o8z:U, 6o90:U, 7p7q:W, 7p7r:W, 7p7s:W, 7p7t:W, 7p7u:W, 6w6p:U, 6wu9:U |
13 | 1poy:1 | 323 | 45 | 0.0788 | 0.0495 | 0.3556 | 6.7 | 1pot:A, 1poy:2, 1poy:3, 1poy:4 |
14 | 8eug:I | 170 | 126 | 0.1576 | 0.1882 | 0.2540 | 8.9 | 8eui:I |
15 | 8qh3:A | 1310 | 56 | 0.0788 | 0.0122 | 0.2857 | 9.2 | 8c4u:A, 8c4v:A, 8p1m:A, 8p1n:A, 8qgt:A |