BioLiP

>protein
SMFDKPFDYENGSKFAMGIWIGRQMAYGAFLGSIPFLFGLGLVLGSYGLGLMLPERAHQAPSPYT

The query sequence (length=65) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7yml:X	65	65	1.0000	1.0000	1.0000	5.62e-43	8b64:X
2	7vb9:c	68	59	0.3231	0.3088	0.3559	0.15	7f0l:X, 7pil:X, 7pqd:X, 7pqd:x, 7va9:C, 7va9:c, 7vb9:C, 7vnm:X, 7vny:X, 7vor:X, 7vor:x, 7vot:X, 7vot:x, 7vy2:X, 7vy2:x, 7vy3:X
3	6ftf:B	291	34	0.2000	0.0447	0.3824	0.44	6hyi:B, 6hyq:A, 6hyq:B, 6hyq:C, 6hyq:D
4	6flo:A	277	34	0.2154	0.0505	0.4118	0.79	6flo:B, 6h4g:A, 6h4g:B
5	4pz6:A	373	25	0.1538	0.0268	0.4000	3.4	4pz6:B, 4pz8:A
6	2ffl:A	732	42	0.2154	0.0191	0.3333	3.4	2ffl:B, 2ffl:C, 2ffl:D, 2qvw:A, 2qvw:B, 2qvw:C, 2qvw:D
7	8byi:A	320	26	0.1846	0.0375	0.4615	7.6	8byi:B, 8byi:C, 8byi:D, 8byi:E
8	6ih6:A	330	31	0.2154	0.0424	0.4516	7.6	6ih3:A, 6ih5:B, 6ih6:B
9	5csl:A	2050	35	0.2154	0.0068	0.4000	8.1
10	5csl:B	2072	35	0.2154	0.0068	0.4000	8.1	5ctb:A, 5ctb:C, 5ctc:A, 5ctc:B, 5ctc:C, 5cte:B, 5cte:C, 3h0s:A, 3k8x:A, 3k8x:B, 3k8x:C, 1od2:A, 1od2:B, 3pgq:A, 3pgq:C, 3tv5:A, 3tv5:B, 3tv5:C, 3tvu:A, 3tvu:B, 3tvu:C, 3tvw:A, 3tvw:B, 3tvw:C, 3tz3:A, 3tz3:B, 3tz3:C, 1w96:A, 1w96:B, 1w96:C, 4wyo:B, 4wyo:C, 4wz8:B, 4wz8:C
11	5v2p:A	287	51	0.2615	0.0592	0.3333	9.2	4dey:A

[Back]