SLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAEVLIEWLQN
The query sequence (length=44) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8iw5:B | 44 | 44 | 1.0000 | 1.0000 | 1.0000 | 2.32e-26 | |
2 | 6xe6:A | 826 | 40 | 0.2727 | 0.0145 | 0.3000 | 2.4 | |
3 | 7e2i:D | 907 | 40 | 0.2727 | 0.0132 | 0.3000 | 2.4 | 7e2g:D, 7e2h:E |
4 | 4mzu:F | 294 | 22 | 0.2500 | 0.0374 | 0.5000 | 3.9 | 4mzu:A, 4mzu:C, 4mzu:E, 4mzu:B, 4mzu:D, 4mzu:G, 4mzu:I, 4mzu:K, 4mzu:H, 4mzu:J, 4mzu:L, 4zu4:A, 4zu4:B, 4zu4:C |
5 | 3n1c:A | 309 | 28 | 0.2500 | 0.0356 | 0.3929 | 3.9 | 3cqd:A, 3cqd:B, 3n1c:D, 3n1c:B, 3n1c:C, 3umo:A, 3umo:B, 3ump:A, 3ump:B, 3uqd:A, 3uqd:C, 3uqd:B, 3uqd:D, 3uqe:A, 3uqe:B |
6 | 6due:A | 737 | 37 | 0.2273 | 0.0136 | 0.2703 | 4.5 | |
7 | 8ro2:C | 908 | 17 | 0.1818 | 0.0088 | 0.4706 | 5.1 | 7aav:r, 7abf:r, 7abg:r, 7abi:r, 6ah0:C, 6ahd:C, 8c6j:C, 8ch6:b, 7dvq:C, 6ff4:B, 6ff7:B, 9fmd:C, 8h6e:5C, 8h6j:5C, 8h6k:5C, 8h6l:5C, 8i0p:C, 8i0r:C, 8i0s:C, 8i0t:C, 8i0u:C, 8i0v:C, 8i0w:C, 6icz:C, 6id0:C, 6id1:C, 8q7q:C, 8q7v:C, 8q7w:C, 8q7x:C, 8q91:C, 6qdv:C, 8qp8:C, 7qtt:b, 6qw6:5C, 6qx9:5C, 8rc0:C, 7w59:C, 7w5a:C, 7w5b:C, 5xjc:C, 8y6o:D, 5yzg:C, 5z56:C, 5z57:C, 5z58:C, 6zym:B |
8 | 1vyk:A | 129 | 26 | 0.2273 | 0.0775 | 0.3846 | 7.5 |