BioLiP

>protein
SIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKI

The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3f21:A	67	64	1.0000	0.9552	1.0000	1.01e-41	2acj:B, 2acj:C, 2acj:D, 3f21:B, 3f21:C, 3f22:A, 3f22:B, 3f22:C, 3f23:A, 3f23:B, 3f23:C, 2gxb:A, 2gxb:B, 3irq:B, 3irq:A, 3irq:D, 3irq:C, 3irr:C, 3irr:D, 3irr:A, 3irr:B, 1qbj:A, 1qbj:B, 1qbj:C, 5zu1:C, 5zu1:A, 5zu1:B, 5zuo:B, 5zuo:C, 5zuo:D, 5zup:B, 5zup:C, 5zup:D
2	2acj:A	53	58	0.7656	0.9245	0.8448	1.66e-27	5zuo:A, 5zup:A
3	5zu1:D	47	58	0.6719	0.9149	0.7414	2.86e-21
4	7c0i:B	67	39	0.3594	0.3433	0.5897	2.33e-09	7c0i:A, 7c0i:C
5	4kmf:A	62	58	0.2656	0.2742	0.2931	4.88e-05
6	1sfu:A	70	46	0.2812	0.2571	0.3913	1.66e-04	1sfu:B
7	2heo:A	59	58	0.3125	0.3390	0.3448	7.45e-04	2heo:D, 1j75:A
8	7c0j:B	62	29	0.2656	0.2742	0.5862	0.002	7c0j:A
9	4lb5:B	63	60	0.2969	0.3016	0.3167	0.023	4lb5:A, 4lb6:B
10	4ev0:D	214	50	0.2656	0.0794	0.3400	0.17	4ev0:A
11	3qph:A	335	40	0.1875	0.0358	0.3000	1.6	2f5t:X
12	3byr:A	89	29	0.1719	0.1236	0.3793	2.0
13	6zj3:LT	190	28	0.1875	0.0632	0.4286	5.2
14	1c3r:A	372	51	0.2969	0.0511	0.3725	5.5	1c3r:B, 1c3s:A
15	8inz:C	465	34	0.1719	0.0237	0.3235	9.6	8inz:A, 8inz:B, 8inz:D, 8io3:C, 8io3:A, 8io3:B, 8io3:D

[Back]