SIKKTLFVVIALSLVCSIIVSAAAVGLRDKQKENAALDKQSKILQVAGIEAKGSKQIVELFNKSIEPRLVDFNTGDFVEG
DAANYDQRKAAKEASESIKLTAEQDKAKIQRRANVGVVYLVKDGDKTSKVILPVHGNGLWSMMYAFVAVETDGNTVSGLT
YYEQGETPGLGGEVENPAWRAQWVGKKLFDENHKPAIKIVKGGAPQGSEHGVDGLSGATLTSNGVQNTFDFWLGDMGFGP
FLTKVRDG
The query sequence (length=248) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8a1y:C | 253 | 248 | 1.0000 | 0.9802 | 1.0000 | 0.0 | 8a1t:C, 8a1u:C, 8a1v:C, 8a1w:C, 8a1x:C, 8acw:C, 8acy:C, 8ad0:C, 8evu:C, 8ew3:C, 4u9s:C, 7xk3:C, 7xk4:C, 7xk5:C, 7xk6:C, 7xk7:C |
2 | 4xa7:A | 226 | 224 | 0.7419 | 0.8142 | 0.8214 | 2.86e-133 | |
3 | 4xhf:B | 225 | 210 | 0.3629 | 0.4000 | 0.4286 | 1.69e-52 | 4xhf:A, 4xhf:C, 4xhf:D |
4 | 7zc6:G | 187 | 155 | 0.1774 | 0.2353 | 0.2839 | 9.07e-06 | |
5 | 6jn7:A | 262 | 114 | 0.1210 | 0.1145 | 0.2632 | 1.4 | 7e60:A, 7e61:A, 7e63:A, 7e63:B, 7e64:A, 7e65:A, 7e65:B, 7e66:A, 7e67:A, 7e69:A, 6jmx:A, 6jmy:A, 6jmz:A, 6jn0:A, 6jn1:A, 6jn7:B, 6jn7:C, 6jn8:A, 6kv1:A |
6 | 7tbw:A | 1928 | 49 | 0.0645 | 0.0083 | 0.3265 | 6.4 | |
7 | 6f8z:A | 715 | 100 | 0.0887 | 0.0308 | 0.2200 | 9.8 | 6f8z:B, 6f8z:C, 6f90:A, 6f90:B, 6f90:C |