SHMEQRILKFLGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIA
The query sequence (length=47) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5zu1:D | 47 | 47 | 1.0000 | 1.0000 | 1.0000 | 1.13e-28 | |
2 | 2acj:A | 53 | 52 | 0.9574 | 0.8491 | 0.8654 | 7.26e-25 | 5zuo:A, 5zup:A |
3 | 3f21:A | 67 | 59 | 0.9362 | 0.6567 | 0.7458 | 4.42e-22 | 2acj:B, 2acj:C, 2acj:D, 3f21:B, 3f21:C, 3f22:A, 3f22:B, 3f22:C, 3f23:A, 3f23:B, 3f23:C, 2gxb:A, 2gxb:B, 3irq:B, 3irq:A, 3irq:D, 3irq:C, 3irr:C, 3irr:D, 3irr:A, 3irr:B, 1qbj:A, 1qbj:B, 1qbj:C, 5zu1:C, 5zu1:A, 5zu1:B, 5zuo:B, 5zuo:C, 5zuo:D, 5zup:B, 5zup:C, 5zup:D |
4 | 7c0i:B | 67 | 32 | 0.4255 | 0.2985 | 0.6250 | 6.45e-08 | 7c0i:A, 7c0i:C |
5 | 7c0j:B | 62 | 30 | 0.3830 | 0.2903 | 0.6000 | 2.77e-04 | 7c0j:A |
6 | 4kmf:A | 62 | 58 | 0.3617 | 0.2742 | 0.2931 | 0.002 | |
7 | 2heo:A | 59 | 60 | 0.3830 | 0.3051 | 0.3000 | 0.033 | 2heo:D, 1j75:A |
8 | 1sfu:A | 70 | 33 | 0.2553 | 0.1714 | 0.3636 | 0.44 | 1sfu:B |
9 | 6zj3:LT | 190 | 26 | 0.2553 | 0.0632 | 0.4615 | 1.4 | |
10 | 1pjq:B | 455 | 36 | 0.2979 | 0.0308 | 0.3889 | 1.7 | 6p5x:A, 6p5x:B, 6p5z:A, 6p5z:B, 6p7c:A, 6p7c:B, 6p7d:A, 6p7d:B, 1pjs:A, 1pjs:B, 1pjt:A, 1pjt:B, 6pqz:A, 6pqz:B, 6pr0:A, 6pr0:B, 6pr1:A, 6pr1:B, 6pr2:A, 6pr2:B, 6pr3:A, 6pr3:B, 6pr4:A, 6pr4:B, 6ulu:A, 6ulu:B, 6veb:A, 6veb:B |
11 | 1xp3:A | 297 | 28 | 0.2340 | 0.0370 | 0.3929 | 2.4 | |
12 | 6wbf:A | 344 | 18 | 0.1702 | 0.0233 | 0.4444 | 6.9 | 7f8j:A, 7f8j:G, 7f8j:B, 7f8j:C, 7f8j:D, 7f8j:E, 7f8j:F, 7f8n:A, 7f8n:B, 7f8n:C, 7f8n:D, 7f8n:E, 7f8n:F, 7f8n:G, 7f8o:A, 7f8o:B, 7f8o:C, 7f8o:D, 7f8o:E, 7f8o:F, 7f8o:G, 8gyo:A, 8gyo:B, 8gyo:D, 8gyo:E, 8gyo:F, 6wbf:B, 6wbf:C, 6wbf:D, 6wbf:E, 6wbf:F, 6wbf:G, 6wbg:A, 6wbg:B, 6wbg:C, 6wbg:D, 6wbg:E, 6wbg:F, 6wbg:G |
13 | 6syt:A | 1896 | 22 | 0.1915 | 0.0047 | 0.4091 | 7.1 | |
14 | 7pw9:A | 1952 | 22 | 0.1915 | 0.0046 | 0.4091 | 7.4 | 7pw4:A, 7pw5:A, 7pw6:A, 7pw7:A, 7pw8:A, 6z3r:A |
15 | 6agi:B | 322 | 19 | 0.2128 | 0.0311 | 0.5263 | 8.8 | 6agi:A |