Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
SHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREAR

The query sequence (length=43) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 8s8o:A 52 43 1.0000 0.8269 1.0000 4.31e-26 2drn:A, 2drn:B, 2h9r:B, 2hwn:A, 2hwn:B, 2hwn:C, 2hwn:D, 2izx:A, 2izx:B, 8s8o:B, 3tmh:B, 3tmh:G, 4zp3:A, 4zp3:B, 4zp3:C, 4zp3:D, 4zp3:E, 4zp3:F, 4zp3:L, 4zp3:I, 4zp3:J, 4zp3:K
2 8q0n:B 831 27 0.2326 0.0120 0.3704 1.4
3 1fx7:A 230 34 0.3023 0.0565 0.3824 4.6 1b1b:A, 1fx7:B, 1fx7:C, 1fx7:D, 2isz:A, 2isz:B, 2isz:C, 2isz:D, 2it0:A, 2it0:B, 2it0:C, 2it0:D, 1u8r:A, 1u8r:B, 1u8r:C, 1u8r:D, 1u8r:G, 1u8r:H, 1u8r:I, 1u8r:J
4 6bq1:E 1510 22 0.2326 0.0066 0.4545 9.2 6bq1:A
5 6g0c:A 624 27 0.2093 0.0144 0.3333 9.2
6 4okd:A 801 23 0.2326 0.0125 0.4348 9.8 4okd:B

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218