BioLiP

>protein
SGTRYSWKVSGMDCAACARKVENAVRQLAGVNQVQVLFATEKLVVDADNDIRAQVESALQKAGYSLRDEQAAE

The query sequence (length=73) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1mwz:A	73	73	1.0000	1.0000	1.0000	1.31e-48
2	4a48:B	69	63	0.3151	0.3333	0.3651	2.02e-09	4a48:A, 4a4j:A, 2xmw:A
3	1oq6:A	76	63	0.2877	0.2763	0.3333	1.14e-07
4	1kqk:A	80	64	0.3151	0.2875	0.3594	3.03e-06
5	1afj:A	72	63	0.3288	0.3333	0.3810	4.74e-05
6	1fvs:A	72	64	0.2603	0.2639	0.2969	8.60e-05	2ggp:B
7	6a71:B	71	31	0.1781	0.1831	0.4194	2.30e-04	6a72:A
8	1k0v:A	73	63	0.2877	0.2877	0.3333	5.49e-04	3i9z:A, 2qif:A, 2qif:B
9	1yjt:A	75	43	0.2055	0.2000	0.3488	0.002	1yjv:A
10	4y2i:A	65	63	0.2740	0.3077	0.3175	0.002
11	8ioy:A	816	43	0.1918	0.0172	0.3256	0.002
12	7si6:A	873	43	0.2055	0.0172	0.3488	0.007	7si3:A, 7si7:A
13	2nyt:B	190	62	0.2466	0.0947	0.2903	0.013	2nyt:A, 2nyt:C, 2nyt:D
14	2rpz:A	192	62	0.2329	0.0885	0.2742	0.020
15	3dxs:X	74	28	0.1781	0.1757	0.4643	0.11
16	1kvj:A	79	54	0.1918	0.1772	0.2593	0.23	3cjk:B, 2k1r:A, 5t7l:B
17	4yuu:o2	245	54	0.2466	0.0735	0.3333	0.50	4yuu:O1
18	1y3j:A	77	29	0.1370	0.1299	0.3448	0.68
19	7xcm:A	494	32	0.1781	0.0263	0.4062	2.5	7xcm:B, 7xcm:C, 7xcm:D, 7xcm:E, 7xcm:F, 7xcn:A, 7xcn:B, 7xcn:C, 7xcn:D, 7xcn:E, 7xcn:F
20	5t7l:A	68	52	0.1644	0.1765	0.2308	5.0	1fee:A, 3iwl:A, 3iwx:A, 3iwx:B, 4qot:A, 4qot:B, 1tl4:A, 4ydx:A, 7zc3:A
21	5hnf:A	280	50	0.1918	0.0500	0.2800	6.9	5hlt:B, 5hlt:A, 5hnh:A, 2vla:A

[Back]