BioLiP

>protein
SGQIKVLYANKETNSTTNTIRPWLKVVNTGSSSIDLSRVTIRYWYTVDGDRAQSAISDWAQIGASNVTFKFVKLSSSVSG
ADYYLEIGFKSGAGQLQPGKDTGEIQIRFNKSDWSNYNQGNDWSWLQSMTSYGENVKVTAYIDGVLVWGQEPS

The query sequence (length=153) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6d5b:B	154	153	1.0000	0.9935	1.0000	1.03e-109	6d5b:A, 6d5b:C, 6d5b:D, 6d5b:E, 6d5b:F, 6d5b:G, 6d5b:H, 6d5b:I, 6d5b:J, 6d5b:K, 6d5b:L
2	4jo5:A	170	161	0.5229	0.4706	0.4969	9.17e-43	4b9f:A, 4b9f:B, 1nbc:A, 1nbc:B
3	3zqw:A	153	149	0.4641	0.4641	0.4765	1.09e-42	3zu8:A, 3zuc:A
4	4b97:A	151	151	0.4314	0.4371	0.4371	4.52e-39
5	2wo4:A	159	149	0.3725	0.3585	0.3826	2.43e-30	2wnx:A, 2wob:A, 2wob:C, 2wob:E
6	6sl4:A	150	149	0.3660	0.3733	0.3758	3.36e-29	6sl4:B, 6sl4:C
7	1g43:A	160	160	0.3791	0.3625	0.3625	1.48e-27
8	4b9p:A	166	162	0.3791	0.3494	0.3580	8.84e-23
9	3zqx:A	146	149	0.3203	0.3356	0.3289	9.33e-22
10	4b9c:A	150	131	0.3072	0.3133	0.3588	3.27e-15
11	4b96:A	151	150	0.3137	0.3179	0.3200	9.97e-15
12	1js4:A	605	117	0.1961	0.0496	0.2564	7.70e-04	1js4:B, 1tf4:A, 1tf4:B, 3tf4:A, 3tf4:B, 4tf4:A, 4tf4:B
13	2xfg:B	172	76	0.1699	0.1512	0.3421	0.013
14	8u49:A	615	74	0.1569	0.0390	0.3243	0.41	8u4a:A, 8u4f:A
15	4ni3:B	583	53	0.0915	0.0240	0.2642	8.3	4ni3:A, 4psr:A, 4psr:B
16	6kbn:C	504	31	0.0719	0.0218	0.3548	8.8	6kbm:A, 6kbn:A

[Back]