SGFGDKFKRPVGSWECPVCCVSNKAEDSRCVSCTSEKP
The query sequence (length=38) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7mo3:B | 38 | 38 | 1.0000 | 1.0000 | 1.0000 | 3.57e-22 | 7mo3:D, 7mo4:B, 7mo4:D |
2 | 2ebv:A | 57 | 37 | 0.8158 | 0.5439 | 0.8378 | 1.87e-18 | |
3 | 7mo2:B | 38 | 38 | 0.5526 | 0.5526 | 0.5526 | 1.62e-10 | 3ch5:B, 7mo2:D |
4 | 7mo5:B | 36 | 34 | 0.5263 | 0.5556 | 0.5882 | 2.03e-10 | |
5 | 7mnv:B | 38 | 38 | 0.4737 | 0.4737 | 0.4737 | 3.05e-06 | |
6 | 7mns:B | 38 | 34 | 0.3947 | 0.3947 | 0.4412 | 7.02e-06 | |
7 | 7mnt:B | 38 | 34 | 0.3421 | 0.3421 | 0.3824 | 6.39e-05 | 7mnt:D, 7mnu:B |
8 | 2ebr:A | 47 | 25 | 0.3158 | 0.2553 | 0.4800 | 1.78e-04 | |
9 | 2ebq:A | 47 | 28 | 0.3421 | 0.2766 | 0.4643 | 2.05e-04 | 2gqe:A, 2k0c:A |
10 | 7mo1:B | 34 | 25 | 0.2632 | 0.2941 | 0.4000 | 0.002 | |
11 | 7mnp:B | 39 | 26 | 0.2895 | 0.2821 | 0.4231 | 0.006 | 7mnp:D, 7mnq:B |
12 | 7mnr:B | 40 | 31 | 0.2632 | 0.2500 | 0.3226 | 0.056 | |
13 | 2d9g:A | 53 | 26 | 0.2895 | 0.2075 | 0.4231 | 0.20 | |
14 | 8pp6:K | 36 | 26 | 0.2895 | 0.3056 | 0.4231 | 0.66 | |
15 | 2j9u:B | 47 | 16 | 0.2105 | 0.1702 | 0.5000 | 1.2 | 2j9u:D |
16 | 8f5o:B | 1134 | 23 | 0.2632 | 0.0088 | 0.4348 | 1.4 | 8f5p:B |
17 | 2naa:A | 94 | 30 | 0.3947 | 0.1596 | 0.5000 | 1.5 | |
18 | 9b4h:A | 1908 | 31 | 0.2368 | 0.0047 | 0.2903 | 1.7 | 9b4h:B, 8wa2:A, 8wa2:D, 8wa2:F, 8wa2:B, 8wa2:C, 8wa2:E |
19 | 8ppt:B | 1191 | 14 | 0.2105 | 0.0067 | 0.5714 | 2.3 | 8ppu:B, 8ppv:B, 6t8h:B |
20 | 3chv:A | 279 | 11 | 0.1842 | 0.0251 | 0.6364 | 3.4 | |
21 | 5diz:A | 474 | 26 | 0.3158 | 0.0253 | 0.4615 | 3.4 | 5diz:B, 5ft9:A, 5ft9:B |
22 | 6bni:A | 502 | 15 | 0.2368 | 0.0179 | 0.6000 | 3.6 | 6bni:B, 6c86:A, 6c86:B, 5eln:A, 5eln:B, 5eln:C, 5eln:D, 5elo:A, 5elo:B, 5elo:C, 5elo:D, 6hcw:A, 6hcw:B, 7zog:A, 7zog:B, 7zog:C, 7zog:D |
23 | 4pne:B | 272 | 37 | 0.2895 | 0.0404 | 0.2973 | 3.6 | 4pne:A |
24 | 2crc:A | 52 | 29 | 0.3158 | 0.2308 | 0.4138 | 5.4 | |
25 | 7qty:A | 279 | 16 | 0.2368 | 0.0323 | 0.5625 | 5.4 | 7qu0:A |
26 | 8im5:A | 66 | 29 | 0.3158 | 0.1818 | 0.4138 | 6.0 | 3b0a:E |
27 | 6me8:A | 449 | 29 | 0.2632 | 0.0223 | 0.3448 | 6.3 | 6me6:A, 6me7:A, 6me9:A |
28 | 2dsx:A | 52 | 22 | 0.2632 | 0.1923 | 0.4545 | 7.6 | 1rdg:A |
29 | 5jne:A | 351 | 17 | 0.1579 | 0.0171 | 0.3529 | 9.6 | 3i2d:A, 5jne:E |
30 | 8fkx:NF | 209 | 27 | 0.2632 | 0.0478 | 0.3704 | 10.0 | 8fkr:NF, 8fks:NF, 8fkt:NF, 8fku:NF, 8fky:NF |