SEPQRLFFAIDLPAEIREQIIHWRAKHFPPEAGRPVAADNLHLTLAFLGEVSAEKEKALSLLAGRIRQPGFTLTLDDAGQ
WLRSRVVWLGMRQPPRGLIQLANMLRSQAARSGCFPFHPHITLLRDASEAVTIPPPGFNWSYAVTEFTLYASSFARGRTR
YTPLKRWALTQ
The query sequence (length=171) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5ldj:B | 175 | 175 | 1.0000 | 0.9771 | 0.9771 | 7.27e-123 | 5ldj:A, 5ldj:C, 5ldj:D, 5ldk:B, 5ldm:A, 5ldm:B, 5ldo:A, 5ldp:A, 5ldp:B, 5ldq:A, 5ldq:B, 5ldq:C, 5ldq:D, 4qak:A, 4qak:B |
2 | 5h7e:A | 182 | 156 | 0.2924 | 0.2747 | 0.3205 | 1.83e-09 | |
3 | 8aq2:A | 520 | 122 | 0.1988 | 0.0654 | 0.2787 | 0.078 | |
4 | 8har:A | 357 | 114 | 0.1871 | 0.0896 | 0.2807 | 0.66 | 8har:B |
5 | 4j8g:B | 302 | 46 | 0.0936 | 0.0530 | 0.3478 | 5.7 | 4j8b:A, 4j8g:A |
6 | 9bgr:B | 371 | 24 | 0.0702 | 0.0323 | 0.5000 | 8.7 | 9bgr:A |
7 | 1pjq:B | 455 | 72 | 0.1228 | 0.0462 | 0.2917 | 9.8 | 6p5x:A, 6p5x:B, 6p5z:A, 6p5z:B, 6p7c:A, 6p7c:B, 6p7d:A, 6p7d:B, 1pjs:A, 1pjs:B, 1pjt:A, 1pjt:B, 6pqz:A, 6pqz:B, 6pr0:A, 6pr0:B, 6pr1:A, 6pr1:B, 6pr2:A, 6pr2:B, 6pr3:A, 6pr3:B, 6pr4:A, 6pr4:B, 6ulu:A, 6ulu:B, 6veb:A, 6veb:B |