SEIRKLLQEIKKQVDNPGNSSTTEIKKMASEAGIDEQTAEEIYHLLTEFYQAVEEHGGIEKYMHSNISWLKIELELLSAC
YQIAILEDMKVLDISEMLSLNDLRIFPKTPSQLQNTYYKLKKELIQVEDIPKNKPGRKRK
The query sequence (length=140) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3fdq:A | 140 | 140 | 1.0000 | 1.0000 | 1.0000 | 5.34e-101 | 3fdq:B |
2 | 8y7g:B | 543 | 35 | 0.0929 | 0.0239 | 0.3714 | 0.53 | 8y7g:A |
3 | 6kcl:B | 545 | 47 | 0.1214 | 0.0312 | 0.3617 | 1.6 | 6jwu:B, 6jwv:B, 6jwx:B, 6jwy:B |
4 | 6iie:A | 87 | 32 | 0.0786 | 0.1264 | 0.3438 | 2.6 | |
5 | 4ncl:B | 435 | 33 | 0.0929 | 0.0299 | 0.3939 | 5.6 | 4ncl:A, 4ncn:A, 4ncn:B, 4tmt:A, 4tmt:B, 4tmv:B, 4tmv:A, 4tmw:A, 4tmw:B, 4tmx:A, 4tmx:B, 4tmz:B, 4tmz:A, 4tn1:B, 4tn1:A |
6 | 6h0a:A | 339 | 111 | 0.1929 | 0.0796 | 0.2432 | 6.1 | 6g82:A, 6gmu:A, 4hho:A, 4hhq:A, 4q1u:A, 3sre:A, 3srg:A, 1v04:A |
7 | 3ke6:A | 354 | 42 | 0.0786 | 0.0311 | 0.2619 | 7.7 | 3ke6:B |
8 | 7obr:x | 488 | 49 | 0.1000 | 0.0287 | 0.2857 | 8.2 | 2go5:W, 2j37:W, 5l3q:A, 5l3q:C, 1mfq:C, 7nfx:x, 7qwq:x, 1ry1:W, 4ue5:D, 6y2z:A, 6y32:A, 6y32:C, 6y32:E, 6y32:G |
9 | 7d1c:A | 491 | 41 | 0.1000 | 0.0285 | 0.3415 | 8.5 | 4ct0:A, 7d19:A, 7d19:B, 7dli:A, 7dli:B, 7dli:C, 6kx5:A, 6kx6:A, 6kx6:B, 6kx7:A, 6lue:A, 6lue:B, 7wva:A |
10 | 6o7e:Y | 361 | 61 | 0.1214 | 0.0471 | 0.2787 | 8.9 | 6o7h:F, 6o7i:F |