SEGVLNQAVKLPRGEDENEWLAVHCVDFYNQINMLYGSITEFCSPQTCPRMIATNEYEYLWAFQPPVSVSAPKYVECLMR
WCQDQFDDESLFPSKVTGTFPEGFIQRVIQPILRRLFRVYAHIYCHHFNEILELNLQTVLNTSFRHFCLFAQEFELLRPA
DFGPLLELVMELR
The query sequence (length=173) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2hjn:A | 206 | 176 | 0.9827 | 0.8252 | 0.9659 | 7.58e-124 | 5ncn:A |
2 | 5brk:A | 194 | 172 | 0.5549 | 0.4948 | 0.5581 | 5.15e-67 | 5b5v:A, 5b5v:C, 5b5v:B, 5b5v:D, 5b5w:A, 5b6b:A, 5b6b:B, 5b6b:D, 5b6b:F, 5b6b:H, 5b6b:K, 5b6b:M, 5b6b:O, 5brm:A, 5brm:B, 5brm:C, 5brm:D, 5brm:E, 5brm:F, 4j1v:A, 4j1v:C, 4jiz:A, 6mcp:B, 6mcp:D, 6mcq:B, 6mcq:D, 1pi1:A, 5twf:A, 5twf:B, 5twg:A, 5twh:A, 5xqz:A, 5xqz:B |
3 | 5ncm:A | 183 | 168 | 0.3295 | 0.3115 | 0.3393 | 4.11e-35 | |
4 | 7k36:H | 177 | 134 | 0.1908 | 0.1864 | 0.2463 | 1.07e-04 | |
5 | 5yf4:A | 129 | 132 | 0.1908 | 0.2558 | 0.2500 | 0.004 | |
6 | 8hw1:A | 241 | 18 | 0.0636 | 0.0456 | 0.6111 | 1.8 | 8hw1:K, 8hw1:B, 8hw1:C, 8hw1:D, 8hw1:E, 8hw1:F, 8hw1:G, 8hw1:H, 8hw1:I, 8hw1:J |
7 | 7edb:A | 350 | 118 | 0.1676 | 0.0829 | 0.2458 | 2.5 | 7edb:B |
8 | 5t9g:C | 811 | 27 | 0.0636 | 0.0136 | 0.4074 | 5.0 | 5t9g:A, 5t9g:B, 5t9g:D |
9 | 3gfb:A | 347 | 34 | 0.0578 | 0.0288 | 0.2941 | 7.0 | 3gfb:B, 3gfb:C, 3gfb:D |