SDPALLAEIRQSLDATKGLTSVHVAVRTTGKVDSLLGITSADVDVRANPLAAKGVCTYNDEQGVPFRVQGDNISVKLFDD
WSNLGSISELSTSRVGVTQLLSGVTNLQAQGTEVIDGISTTKITGTIPASSVKMLDPGAKSARPATVWIAQDGSHHLVRA
SIDLGSGSIQLTQSKWNEPVNVD
The query sequence (length=183) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2byo:A | 183 | 183 | 1.0000 | 1.0000 | 1.0000 | 1.44e-131 | |
2 | 4zra:A | 196 | 195 | 0.3169 | 0.2959 | 0.2974 | 2.02e-18 | 3mha:A |
3 | 4qa8:A | 210 | 197 | 0.3169 | 0.2762 | 0.2944 | 3.00e-11 | |
4 | 6tqn:A | 495 | 34 | 0.0929 | 0.0343 | 0.5000 | 0.91 | 6gov:A, 5lm7:A, 5lm7:C, 5lm9:A, 5ms0:M, 6tqo:A, 1u9l:A, 1u9l:B, 7ubn:N, 6xas:G |
5 | 7vc7:A | 743 | 109 | 0.1749 | 0.0431 | 0.2936 | 1.9 | |
6 | 4b28:A | 437 | 23 | 0.0601 | 0.0252 | 0.4783 | 4.1 | |
7 | 7bye:F | 98 | 29 | 0.0874 | 0.1633 | 0.5517 | 8.2 | |
8 | 7bye:B | 108 | 29 | 0.0874 | 0.1481 | 0.5517 | 8.9 | 7bye:C, 7bye:E |
9 | 8x2h:A | 2363 | 41 | 0.0820 | 0.0063 | 0.3659 | 8.9 | 8jb5:A, 2vkd:A, 2vkd:B, 2vkd:C, 2vkh:A, 2vkh:B, 2vkh:C, 2vl8:A, 2vl8:B, 2vl8:C |