SDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARER
DAYKVKSEKLANSG
The query sequence (length=94) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2wty:B | 97 | 94 | 1.0000 | 0.9691 | 1.0000 | 4.39e-64 | 4auw:A, 4auw:B, 4auw:E, 4auw:F, 2wt7:B, 2wty:A |
2 | 4eot:A | 92 | 90 | 0.7872 | 0.8043 | 0.8222 | 3.53e-46 | 4eot:B |
3 | 7x5e:E | 101 | 90 | 0.5532 | 0.5149 | 0.5778 | 2.70e-31 | 3a5t:A, 3a5t:B, 7x5e:A, 7x5f:A, 7x5f:E, 7x5g:A, 7x5g:E |
4 | 4par:C | 314 | 92 | 0.2234 | 0.0669 | 0.2283 | 0.96 | 4par:B, 4par:A, 4par:D, 4pba:C, 4pba:B, 4pba:A, 4pba:D |
5 | 6evq:A | 70 | 27 | 0.1383 | 0.1857 | 0.4815 | 1.1 | 6evq:B, 3gjo:A, 3gjo:B, 3gjo:C, 3gjo:D, 5n74:A, 5n74:B, 5n74:C, 5n74:D, 5n74:E, 5n74:F, 5n74:G, 5n74:H, 7olg:A, 7olg:B |
6 | 7x5e:B | 106 | 80 | 0.2021 | 0.1792 | 0.2375 | 1.7 | 7x5e:F, 7x5f:B, 7x5f:F, 7x5g:B, 7x5g:F |
7 | 5vpe:D | 67 | 61 | 0.2128 | 0.2985 | 0.3279 | 2.6 | 5vpe:B, 5vpf:B, 5vpf:D |
8 | 4oht:A | 455 | 38 | 0.1489 | 0.0308 | 0.3684 | 4.1 | 4oht:B, 4ywu:A, 4ywu:B, 4ywv:A, 4ywv:B |
9 | 8gap:A | 1012 | 84 | 0.2340 | 0.0217 | 0.2619 | 5.2 | 5c9h:A, 7lma:A, 7lmb:A, 7uy5:A, 7uy6:A |
10 | 6d6v:A | 980 | 84 | 0.2340 | 0.0224 | 0.2619 | 5.3 | 5c9h:B |
11 | 7pt6:9 | 341 | 34 | 0.1170 | 0.0323 | 0.3235 | 7.3 | 7pt6:I, 7pt7:9 |
12 | 4wzo:71 | 93 | 41 | 0.1277 | 0.1290 | 0.2927 | 7.5 | |
13 | 5lpi:C | 134 | 24 | 0.1064 | 0.0746 | 0.4167 | 9.7 | 5lpi:D, 5lpi:A, 5lpi:B |