BioLiP

>protein
SDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARER
DAYKVKSEKLANSG

The query sequence (length=94) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2wty:B	97	94	1.0000	0.9691	1.0000	4.39e-64	4auw:A, 4auw:B, 4auw:E, 4auw:F, 2wt7:B, 2wty:A
2	4eot:A	92	90	0.7872	0.8043	0.8222	3.53e-46	4eot:B
3	7x5e:E	101	90	0.5532	0.5149	0.5778	2.70e-31	3a5t:A, 3a5t:B, 7x5e:A, 7x5f:A, 7x5f:E, 7x5g:A, 7x5g:E
4	4par:C	314	92	0.2234	0.0669	0.2283	0.96	4par:B, 4par:A, 4par:D, 4pba:C, 4pba:B, 4pba:A, 4pba:D
5	6evq:A	70	27	0.1383	0.1857	0.4815	1.1	6evq:B, 3gjo:A, 3gjo:B, 3gjo:C, 3gjo:D, 5n74:A, 5n74:B, 5n74:C, 5n74:D, 5n74:E, 5n74:F, 5n74:G, 5n74:H, 7olg:A, 7olg:B
6	7x5e:B	106	80	0.2021	0.1792	0.2375	1.7	7x5e:F, 7x5f:B, 7x5f:F, 7x5g:B, 7x5g:F
7	5vpe:D	67	61	0.2128	0.2985	0.3279	2.6	5vpe:B, 5vpf:B, 5vpf:D
8	4oht:A	455	38	0.1489	0.0308	0.3684	4.1	4oht:B, 4ywu:A, 4ywu:B, 4ywv:A, 4ywv:B
9	8gap:A	1012	84	0.2340	0.0217	0.2619	5.2	5c9h:A, 7lma:A, 7lmb:A, 7uy5:A, 7uy6:A
10	6d6v:A	980	84	0.2340	0.0224	0.2619	5.3	5c9h:B
11	7pt6:9	341	34	0.1170	0.0323	0.3235	7.3	7pt6:I, 7pt7:9
12	4wzo:71	93	41	0.1277	0.1290	0.2927	7.5
13	5lpi:C	134	24	0.1064	0.0746	0.4167	9.7	5lpi:D, 5lpi:A, 5lpi:B

[Back]