BioLiP

>protein
SAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVAETCSPFTVLP
ALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVYGFGCEDSLNH
LLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARKVRDVYWKIYNSIYIGSQDALIAHYPRIYND
DKNTYIRYELDYIL

The query sequence (length=254) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6ahd:1	1048	254	1.0000	0.2424	1.0000	0.0	7abg:u, 7abh:u, 7abi:u, 6ah0:1, 7b0i:C, 7b91:C, 7b9c:C, 8ch6:C, 7dvq:1, 6en4:C, 7evo:1, 6ff4:u, 6ff7:u, 8h6e:2G, 8h6j:2G, 8h6k:2G, 8h6l:2G, 8hk1:1, 8i0p:1, 8i0r:1, 8i0s:1, 8i0t:1, 8i0u:1, 7omf:C, 7onb:C, 7opi:C, 7q3l:A, 7q4o:A, 7q4p:A, 8qo9:B1, 7qtt:C, 6qx9:B1, 8qxd:B1, 8qzs:B1, 8r08:B1, 8r09:B1, 8r0a:B1, 8r0b:B1, 8rm5:B1, 7vpx:1, 6y50:u, 6y5q:u, 8y7e:1, 5z56:1, 5z57:1, 5z58:1, 5zya:C
2	6ahd:1	1048	179	0.1339	0.0324	0.1899	0.77	7abg:u, 7abh:u, 7abi:u, 6ah0:1, 7b0i:C, 7b91:C, 7b9c:C, 8ch6:C, 7dvq:1, 6en4:C, 7evo:1, 6ff4:u, 6ff7:u, 8h6e:2G, 8h6j:2G, 8h6k:2G, 8h6l:2G, 8hk1:1, 8i0p:1, 8i0r:1, 8i0s:1, 8i0t:1, 8i0u:1, 7omf:C, 7onb:C, 7opi:C, 7q3l:A, 7q4o:A, 7q4p:A, 8qo9:B1, 7qtt:C, 6qx9:B1, 8qxd:B1, 8qzs:B1, 8r08:B1, 8r09:B1, 8r0a:B1, 8r0b:B1, 8rm5:B1, 7vpx:1, 6y50:u, 6y5q:u, 8y7e:1, 5z56:1, 5z57:1, 5z58:1, 5zya:C
3	7dco:1	930	252	0.6024	0.1645	0.6071	4.05e-106	6g90:O, 5gm6:G, 5nrl:O, 5zwm:1, 5zwo:1
4	5lqw:Q	791	233	0.5276	0.1694	0.5751	1.14e-89
5	5lqw:Q	791	105	0.0945	0.0303	0.2286	4.9
6	4yiv:A	374	87	0.0984	0.0668	0.2874	0.18
7	7mq9:LM	2005	50	0.0669	0.0085	0.3400	0.74
8	7mqa:LM	2041	50	0.0669	0.0083	0.3400	0.74
9	3irb:A	137	42	0.0591	0.1095	0.3571	6.5	3irb:B
10	7crc:B	1112	26	0.0394	0.0090	0.3846	9.9	7crc:A, 7crc:C, 7crc:D, 7xoz:A, 7xoz:B

[Back]