BioLiP

>protein
RVIDREGVYEISLSPTGVSRVCLYPGFVDVKEADWILEQLSQDVPWKQRTYQQPRLTAWYGELPYTYSRITMEPNPHWHP
VLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDCPSLGRSPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVK
IPLDHGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYP

The query sequence (length=203) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8jnr:A	211	210	0.9901	0.9526	0.9571	5.35e-148	2iuw:A, 8jnk:A, 8jnk:C, 8jnk:E, 8jnk:G, 8jnr:E, 8jnr:D
2	8jnr:C	184	206	0.8768	0.9674	0.8641	1.53e-123
3	3h8o:A	206	182	0.3350	0.3301	0.3736	3.08e-31	3btx:A, 3bty:A, 3btz:A, 3bu0:A, 3buc:A, 3h8r:A, 3h8x:A, 4mg2:A, 4mgt:A, 3rzg:A, 3rzh:A, 3rzj:A, 3rzk:A, 3rzl:A, 3rzl:D, 3rzm:A, 3s57:A, 3s5a:A
4	5ylb:A	187	56	0.0837	0.0909	0.3036	0.040	5yl6:A
5	2g37:B	300	48	0.0788	0.0533	0.3333	0.79	2ekg:A, 2ekg:B, 2g37:A, 5m42:A
6	5mza:B	186	46	0.0739	0.0806	0.3261	1.3
7	6u9d:B	607	90	0.0985	0.0329	0.2222	2.0	6bd3:A, 6bd3:B, 6bd9:A, 6bd9:B, 5fem:A, 5fem:B, 5ims:A, 5ims:B, 1jsc:A, 1jsc:B, 1n0h:A, 1n0h:B, 1t9a:A, 1t9a:B, 1t9b:B, 1t9c:A, 1t9c:B, 1t9d:A, 1t9d:D, 6u9d:A, 6u9d:E, 6u9d:F, 6u9d:I, 6u9d:J, 6u9d:M, 6u9d:N, 6u9d:Q, 6u9d:U, 6u9d:V, 5wkc:A, 5wkc:D, 5wkc:B, 5wkc:E
8	1t9b:A	583	90	0.0985	0.0343	0.2222	2.1	1t9d:B, 1t9d:C
9	3nd6:A	152	98	0.1034	0.1382	0.2143	5.8	3nd6:B, 3nd6:C, 3nd6:D, 3nd6:E, 3nd6:F, 3nd7:A, 3nd7:B, 3nd7:C, 3nd7:D, 3nd7:E, 3nd7:F
10	8ia0:CZ	576	66	0.1034	0.0365	0.3182	9.1

[Back]