RVHEVIIFNELGEICAAVHMQKPQVSPCCNTHCSLRNVAKIVEQIDRAVYSIDLAIYTFTSLFLADSIKRALQRGVIIRI
ISDGEMVYSKGSQISMLAQLGVPVRVPITTNLMHNKFCIIDGFERVEEIRLLRKLKFMRPCYSIVISGSVNWTALGLGGN
WENCIITADDKLTATFQAEFQRMWRAFAKT
The query sequence (length=190) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4gel:B | 198 | 190 | 0.9737 | 0.9343 | 0.9737 | 1.52e-139 | 4gel:A, 4gem:A, 4gem:B |
2 | 4ggj:A | 165 | 138 | 0.2263 | 0.2606 | 0.3116 | 9.08e-18 | 4ggk:A |
3 | 1bys:A | 152 | 147 | 0.1947 | 0.2434 | 0.2517 | 1.49e-06 | |
4 | 4jbm:A | 190 | 61 | 0.1000 | 0.1000 | 0.3115 | 0.21 | 4jbm:B |
5 | 1rv8:B | 305 | 43 | 0.0737 | 0.0459 | 0.3256 | 2.0 | 1rv8:A, 1rv8:C, 1rv8:D, 1rvg:A, 1rvg:B, 1rvg:C, 1rvg:D |
6 | 5ifu:B | 445 | 47 | 0.0579 | 0.0247 | 0.2340 | 3.0 | 5ifu:A, 4wi1:A, 4wi1:B |
7 | 6t7k:A | 494 | 47 | 0.0579 | 0.0223 | 0.2340 | 3.2 | 7f96:A, 7f97:A, 7f97:B, 7f97:C, 7f97:D, 4olf:A, 4q15:A, 4q15:B, 7qb7:A, 7qc1:A, 7qc1:D, 7qc1:I, 7qc2:A, 7v9d:A, 4ydq:A, 4ydq:B |
8 | 2pfz:A | 301 | 52 | 0.0789 | 0.0498 | 0.2885 | 3.6 | |
9 | 5diy:A | 463 | 30 | 0.0579 | 0.0238 | 0.3667 | 4.2 | 5diy:B |
10 | 3ial:B | 505 | 57 | 0.0789 | 0.0297 | 0.2632 | 6.5 | 3ial:A |
11 | 2qmi:F | 447 | 72 | 0.0947 | 0.0403 | 0.2500 | 6.5 | 2qmi:E, 2qmi:G, 2qmi:H |
12 | 2wts:A | 197 | 26 | 0.0579 | 0.0558 | 0.4231 | 8.9 |