Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
RQPVELNRTSLYLGLLLVAVLGILFSSYFFN

The query sequence (length=31) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 6wj6:L 31 31 1.0000 1.0000 1.0000 1.09e-15
2 8wql:LD 38 30 0.8710 0.7105 0.9000 5.18e-13 8wql:LE, 8wql:L1
3 7y5e:L6 37 31 0.7742 0.6486 0.7742 9.47e-12 7y5e:l6, 7y7a:LO, 7y7a:lO, 7y7a:LZ, 7y7a:lZ, 4yuu:l2, 4yuu:L2
4 7vd5:L 38 31 0.7742 0.6316 0.7742 5.53e-11 8j5k:L, 8j5k:l, 7vd5:l, 8xlp:L
5 5xnm:L 37 31 0.7419 0.6216 0.7419 4.73e-10 5mdx:L, 5mdx:l, 7oui:L, 7oui:l, 5xnm:l
6 7pi0:L 38 31 0.7097 0.5789 0.7097 3.15e-09 7pi0:l, 7pi5:l, 7pin:l, 7pin:L1, 7piw:L, 7piw:L1, 7pnk:l
7 7ymi:L 36 31 0.7742 0.6667 0.7742 2.20e-06 7ymi:l, 7ymm:1L, 7ymm:2L, 7ymm:3L, 7ymm:4L
8 3a0b:L 37 31 0.8710 0.7297 0.8710 5.64e-05 3a0b:l, 5b66:L, 7czl:L, 7czl:l, 7dxh:l, 7eda:L, 5mx2:L, 5mx2:l, 7nhp:L, 7nhq:L, 4pj0:L, 4pj0:l
9 7xnk:A 348 21 0.3548 0.0316 0.5238 4.9 7tci:A, 7tci:G, 7tci:E, 7tci:C, 4umo:A, 6v01:A, 6v01:J, 6v01:D, 6v01:G, 7xnk:C, 7xnk:E, 7xnk:G, 7xnl:A, 7xnl:C, 7xnl:E, 7xnl:G, 7xnn:B, 7xnn:G, 7xnn:C, 7xnn:E

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218