QVPVYSEQEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRYDHQQFKKRSVEDLKERYYHICAKLANVRA
The query sequence (length=74) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8x19:V | 204 | 74 | 1.0000 | 0.3627 | 1.0000 | 7.87e-50 | 3hm5:A, 4iej:A, 8x15:V, 8x1c:V |
2 | 3k6x:A | 322 | 41 | 0.1622 | 0.0373 | 0.2927 | 1.1 | 3cfx:A, 3cfx:B, 3k6w:A, 3k6x:B |
3 | 7ch3:A | 469 | 39 | 0.1622 | 0.0256 | 0.3077 | 2.1 | |
4 | 7mq8:SQ | 187 | 79 | 0.2568 | 0.1016 | 0.2405 | 2.1 | 7mq9:SQ |
5 | 7ch3:B | 495 | 39 | 0.1622 | 0.0242 | 0.3077 | 2.8 | 7ch3:C, 7ch3:D, 7ch3:E, 7ch3:I, 7ch3:F, 7ch3:G, 7ch3:H, 7ch3:J, 7ch3:K, 7ch3:L, 7cwv:A, 7cwv:B, 7cwv:C, 7cwv:D, 7cwv:E, 7cwv:F, 7cwv:G, 7cwv:H, 7cwv:I, 7cwv:J, 7cwv:K, 7cwv:L |
6 | 8sr6:A | 451 | 59 | 0.2162 | 0.0355 | 0.2712 | 2.8 | 5czy:A, 8swi:A |
7 | 8fgw:A | 1081 | 23 | 0.1351 | 0.0093 | 0.4348 | 4.2 | |
8 | 1sli:A | 679 | 31 | 0.1622 | 0.0177 | 0.3871 | 6.4 | 2sli:A, 3sli:A, 4sli:A |
9 | 5t99:A | 757 | 32 | 0.1892 | 0.0185 | 0.4375 | 6.9 | 5t99:B |
10 | 3qn3:A | 415 | 22 | 0.1486 | 0.0265 | 0.5000 | 7.5 | 3qn3:B, 3qn3:C, 3qn3:D |
11 | 8b9s:A | 259 | 37 | 0.1622 | 0.0463 | 0.3243 | 8.5 | 8b9s:B, 8b9s:C, 8b9s:E, 8b9s:F, 7q4h:A, 7q4h:B, 7q4j:A, 7q4j:B |
12 | 6bxn:A | 294 | 27 | 0.1081 | 0.0272 | 0.2963 | 9.8 | |
13 | 6bxo:A | 321 | 27 | 0.1081 | 0.0249 | 0.2963 | 9.8 | 6bxm:A, 6bxm:B, 6bxn:B, 6bxo:B |