QVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTM
LPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGETHIAASTKANSYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFP
EINHAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLNTKVEQVPTMLQYATHIKSDSLYNTPPTF
SIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHAEKGSRSLMNVTFNLRNEELNQQFLAKAKEQGFV
GLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKENA
The query sequence (length=358) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4azj:A | 360 | 358 | 1.0000 | 0.9944 | 1.0000 | 0.0 | 4azj:B, 4azk:A, 4azk:B, 2bhx:A, 2bhx:B, 2bi1:A, 2bi1:B, 2bi2:A, 2bi2:B, 2bi3:A, 2bi3:B, 2bi5:A, 2bi5:B, 2bi9:A, 2bi9:B, 2bia:A, 2bia:B, 2bie:A, 2bie:B, 2big:A, 2big:B, 1w23:A, 1w23:B |
2 | 1bt4:A | 361 | 357 | 0.5698 | 0.5651 | 0.5714 | 2.18e-158 | 2c0r:A, 2c0r:B, 1w3u:A |
3 | 6czy:A | 362 | 355 | 0.4553 | 0.4503 | 0.4592 | 8.02e-119 | 6czy:B, 6czy:C, 6czy:D, 6czz:A, 6czz:B, 6czz:C, 6czz:D |
4 | 6xdk:D | 359 | 357 | 0.4246 | 0.4234 | 0.4258 | 4.69e-114 | 6xdk:B, 6xdk:A, 6xdk:C |
5 | 8a5v:E | 366 | 362 | 0.4609 | 0.4508 | 0.4558 | 4.64e-112 | 8a5v:C, 8a5v:F, 8a5v:B, 8a5v:A, 8a5v:G, 8a5v:H, 8a5w:D, 8a5w:C, 8a5w:E, 8a5w:F, 8a5w:B, 8a5w:A, 8a5w:H, 3e77:A, 3e77:B |
6 | 5yb0:B | 349 | 357 | 0.4441 | 0.4556 | 0.4454 | 6.74e-105 | 5yb0:A, 5yb0:C, 5yb0:D, 5yb0:E, 5yb0:F, 5yb0:G, 5yb0:H, 5yb0:I, 5yb0:J, 5yb0:K, 5yd2:A, 5yd2:B |
7 | 3qbo:B | 359 | 357 | 0.4246 | 0.4234 | 0.4258 | 1.64e-102 | 3qbo:A |
8 | 7t7j:B | 360 | 358 | 0.4218 | 0.4194 | 0.4218 | 7.19e-99 | 7t7j:A |
9 | 1bjo:A | 360 | 358 | 0.4106 | 0.4083 | 0.4106 | 1.77e-98 | 1bjo:B |
10 | 3qm2:B | 331 | 358 | 0.4022 | 0.4350 | 0.4022 | 8.91e-84 | 3qm2:A |
11 | 3ffr:A | 361 | 316 | 0.2151 | 0.2133 | 0.2437 | 4.43e-12 | |
12 | 2fyf:A | 368 | 365 | 0.2207 | 0.2147 | 0.2164 | 1.15e-10 | 2fyf:B, 3vom:A, 3vom:B |
13 | 2dr1:A | 381 | 291 | 0.1816 | 0.1706 | 0.2234 | 1.11e-07 | 2dr1:B |
14 | 6mfb:D | 386 | 247 | 0.1536 | 0.1425 | 0.2227 | 1.84e-05 | 6mfb:A, 6mfb:B, 6mfb:C |
15 | 1iug:A | 348 | 187 | 0.1369 | 0.1408 | 0.2620 | 0.065 | 1iug:B |
16 | 3kgw:B | 388 | 327 | 0.1899 | 0.1753 | 0.2080 | 0.14 | 3kgw:A, 3kgx:A |
17 | 2huf:A | 385 | 209 | 0.1229 | 0.1143 | 0.2105 | 0.71 | 2huf:B, 2hui:A, 2hui:B, 2huu:A, 2huu:B |
18 | 3zok:A | 365 | 23 | 0.0335 | 0.0329 | 0.5217 | 6.7 | 3zok:B, 3zok:C, 3zok:D |
19 | 3zja:A | 114 | 74 | 0.0531 | 0.1667 | 0.2568 | 8.5 |